Align isobutyryl-CoA dehydrogenase (EC 1.3.8.1) (characterized)
to candidate WP_085124268.1 B9O00_RS18920 isovaleryl-CoA dehydrogenase
Query= reanno::psRCH2:GFF2392 (383 letters) >NCBI__GCF_900177295.1:WP_085124268.1 Length = 390 Score = 281 bits (720), Expect = 2e-80 Identities = 144/373 (38%), Positives = 222/373 (59%) Query: 6 LSEDQRMIRDMARDFARREIAPHAQAWEKAGWIDDTLVAQMGELGLLGMVVPEEWGGSYI 65 L E+ ++RD F++ IAP A+ ++ W L Q+G LGL G+ V EE+GGS + Sbjct: 13 LGEEADLLRDTVMSFSQERIAPLAERIDREDWFPRELWPQLGALGLHGITVEEEYGGSGL 72 Query: 66 DYVAYALAVEEISAGDGATGALMSIHNSVGCGPVLNYGSQAQKDEWLTELASGRAIGCFA 125 Y+ + +A+EE+S + G H+++ + GS+ QK +L +L SG +G A Sbjct: 73 GYLHHCVAMEEVSRASASVGLSYGAHSNLCVNQIRRNGSEDQKRRYLPKLVSGEHVGSLA 132 Query: 126 LTEPQAGSEAHNLRTRAELVDGHWVLNGSKQFCSNAKRSKLAIVFAVTDPELGKKGLSAF 185 ++EP AGS+ +++TRAE W+LNG K + +NA ++ +++A TDP+ G +G++AF Sbjct: 133 MSEPGAGSDVVSMKTRAEKRGDRWILNGGKMWITNASEAETLVIYAKTDPDAGPRGITAF 192 Query: 186 LVPTDTPGFAVERSEHKMGIRASDTCGVSLSDCRIPEANLLGERGKGLAIALSNLEGGRI 245 +V GF++ + K+G+R S TC + DC +PE N+LGE GKG+ + +S L+ R Sbjct: 193 IVEKGFKGFSIAQKLDKLGMRGSPTCELVFEDCEVPEENVLGEVGKGVRVLMSGLDYERA 252 Query: 246 GIGAQALGIARAAFEAALLYARERVQFGKPIAEHQSIANMLADMQTQLNAARLLILHAAR 305 + A LGI +AA + A+ Y ER QFG+PI Q + LADM T NA R + A+ Sbjct: 253 VLAAGPLGIMQAALDVAIPYVHERKQFGQPIGAFQLVQGKLADMYTTANACRAYVYAVAQ 312 Query: 306 LKSAGLPCLSEASQAKLFASEMAEKVCSQAVQIHGGYGYLEDYPVERYYRDARITQIYEG 365 G +A+ A L+A+E A +V A+Q+ GG GY+ DYP R RDA++ +I G Sbjct: 313 ACDRGETTRKDAAGAILYAAEKATQVALDAIQLLGGNGYINDYPTGRLLRDAKLYEIGAG 372 Query: 366 SSEIQRLLIAREL 378 +SEI+R LI REL Sbjct: 373 TSEIRRWLIGREL 385 Lambda K H 0.318 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 351 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 390 Length adjustment: 30 Effective length of query: 353 Effective length of database: 360 Effective search space: 127080 Effective search space used: 127080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory