Align ABC transporter for Xylitol, ATPase component (characterized)
to candidate WP_085127186.1 B9O00_RS31080 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::Dino:3607124 (338 letters) >NCBI__GCF_900177295.1:WP_085127186.1 Length = 359 Score = 311 bits (796), Expect = 2e-89 Identities = 173/361 (47%), Positives = 231/361 (63%), Gaps = 27/361 (7%) Query: 1 MAGIKIDKINKFYGTTQALFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSSGRI 60 MA + I + K +G T+ + +++ I DG+FVV VGPSGCGKSTLLR LAGLE ++ G I Sbjct: 1 MAAVDIVGVRKAFGATEVIHGVDIAIADGQFVVLVGPSGCGKSTLLRMLAGLESITDGTI 60 Query: 61 EIGGRDVTTVEPADRDLAMVFQSYALYPHMTVRENMEFGMKVNGFEPDLRKERIAEAARV 120 I G+ V V P +RD+AMVFQ+YALYPHM+V +NM F +K+ G R+ EAA + Sbjct: 61 SIDGKVVNLVPPKERDIAMVFQNYALYPHMSVFDNMGFSLKLRGAPKAEIDRRVKEAAAI 120 Query: 121 LQLEDYLDRKPGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLDAKLRVQMRVELEGLH 180 L L+ L+R P QLSGGQRQRVA+GRAIV++P VFLFDEPLSNLDAKLRV MR E+ LH Sbjct: 121 LDLDRLLERFPRQLSGGQRQRVAMGRAIVRDPKVFLFDEPLSNLDAKLRVAMRTEIRALH 180 Query: 181 KQLGATMIYVTHDQVEAMTMADKIVVLNRGRIEQVGSPMDLYHKPNSRFVAEFIGSPAMN 240 ++L +T +YVTHDQ+EAMTMADKIVV++ GR+EQ+G P++LY +P++ FVA FIGSPAMN Sbjct: 181 QRLRSTTVYVTHDQIEAMTMADKIVVMHDGRVEQIGEPLELYDRPDNLFVAGFIGSPAMN 240 Query: 241 V------------FSSDVGLQ----------DISLDASAAFVGCRPEHIEIVPDGDGHIA 278 F SD G+ +D +G RPEH+ + +G A Sbjct: 241 FLPGRIEAGAGPRFVSDGGVSLPLVAPPGGVGSGIDGRPVVLGVRPEHLHLADEG---AA 297 Query: 279 ATVHVKERLGGESLLYLGLKGGGQIVARVGGDDETKVGAAVSLRFSRHRLHQFD-EAGRA 337 A V V E G E ++ L GG ++A + G + + ++H FD E+GR Sbjct: 298 AEVLVVEPTGSEIQVFTKL-GGADVMAVFRERHRFRPGDRIRVAPLPGQIHLFDAESGRR 356 Query: 338 I 338 + Sbjct: 357 L 357 Lambda K H 0.320 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 404 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 359 Length adjustment: 29 Effective length of query: 309 Effective length of database: 330 Effective search space: 101970 Effective search space used: 101970 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory