Align ABC-type sugar transport system, ATPase component protein (characterized, see rationale)
to candidate WP_085120990.1 B9O00_RS03370 sn-glycerol-3-phosphate import ATP-binding protein UgpC
Query= uniprot:D8IPI1 (406 letters) >NCBI__GCF_900177295.1:WP_085120990.1 Length = 375 Score = 342 bits (877), Expect = 1e-98 Identities = 195/380 (51%), Positives = 249/380 (65%), Gaps = 23/380 (6%) Query: 1 MADIHCQALAKHYAGGPPVLHPLDLHIGDGEFVVLLGPSGCGKSTMLRMIAGLEDISGGT 60 MA+I + + K Y G V+H +D+ I DGEF+V++GPSGCGKST+LRM+AGLE I+ G Sbjct: 1 MAEICMRGVRKRY-GDTQVIHGIDVEIADGEFIVIVGPSGCGKSTLLRMVAGLETITEGE 59 Query: 61 LRIGGTVVNDLPARERNVAMVFQNYALYPHMSVYDNIAFGLRRLKRPAAEIDRRVREVAA 120 + IGG VVN L +ER++AMVFQNYALYPHMSV+DN+A+GL+ + P EI RV E A Sbjct: 60 ISIGGRVVNQLEPKERDIAMVFQNYALYPHMSVFDNMAYGLKIARTPKDEIRARVEEAAK 119 Query: 121 LLNLEALLERKPRAMSGGQQQRAAIARAIIKTPSVFLFDEPLSNLDAKLRAQLRGDIKRL 180 LL L LLERKPR +SGGQ+QR A+ RAI++ P+VFLFDEPLSNLDAKLR Q+R +IK+L Sbjct: 120 LLELGGLLERKPRQLSGGQRQRVAMGRAIVRKPAVFLFDEPLSNLDAKLRVQMRLEIKQL 179 Query: 181 HQRLRTTTVYVTHDQLEAMTLADRVILMQDGRIVQAGSPAELYRYPRNLFAAGFIGTPAM 240 ++L TT++YVTHDQ+EAMTLADR+++M GR Q +P +Y P F AGFIG+PAM Sbjct: 180 QRKLGTTSLYVTHDQIEAMTLADRLVVMNQGRAEQIDTPMAVYSDPATTFVAGFIGSPAM 239 Query: 241 NFLSGTVQRQDGQLFIETAHQRWALTGERFSRLRHAMAVKLAVRPDHVRIAGEREPAASL 300 NFL+GTV+ LF+ R + G S L AV L VRP+H+ GE E L Sbjct: 240 NFLAGTVEADGHGLFL-GGDARISDKGSDLSGLA-GRAVTLGVRPEHLLAVGESEAEIRL 297 Query: 301 TCPVSVELVEILGADAL--------LTTRCGDQTLTALVP---ADRLP-----QPGATLT 344 VELVE LGAD L T GD L P RLP + G L Sbjct: 298 ----GVELVETLGADTLAHGRPVGAAGTPLGDAALGGEAPGLITVRLPGLAPVREGERLP 353 Query: 345 LALDQHELHVFDVESGENLS 364 L + + ELH+FD +SG ++ Sbjct: 354 LRMAEGELHLFDPDSGRRIA 373 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 447 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 375 Length adjustment: 31 Effective length of query: 375 Effective length of database: 344 Effective search space: 129000 Effective search space used: 129000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory