Align Monocarboxylic acid transporter (characterized)
to candidate WP_219350057.1 CHB58_RS02245 cation acetate symporter
Query= SwissProt::Q8NS49 (551 letters) >NCBI__GCF_900188395.1:WP_219350057.1 Length = 536 Score = 283 bits (725), Expect = 9e-81 Identities = 181/534 (33%), Positives = 288/534 (53%), Gaps = 44/534 (8%) Query: 21 LNISVFVVFIIVTMTVVLRV------GKSTSESTDFYTGGASFSGTQNGLAIAGDYLSAA 74 ++++ V FIIV ++V + + K T ++ F+ G NGLA+ GDY SAA Sbjct: 1 MSLTYPVAFIIVAVSVFISIYISFYFRKQTRTTSSFFVAGGEIPWKINGLAMFGDYCSAA 60 Query: 75 SFLGIVGAISLNGYDGFLYSIGFFVAWLVALLLVAEPLRNVGRFTMADVLSFRL-RQKPV 133 SFLG+ GAI++ G DG+ ++GFF W+ L LVA PL+N G+FT+ DV+S R + K + Sbjct: 61 SFLGVAGAIAIVGIDGWWLALGFFATWMAVLFLVAGPLKNAGKFTVGDVISERFGKGKDI 120 Query: 134 RVAAACGTLAVTLFYLIAQMAGAGSLVSVLLDIHEFKWQAVVVGIV-GIVMIAYVLLGGM 192 R A TL ++ YL+ Q+ GAG L +LL W + IV G+++ V++GGM Sbjct: 121 RTIAMITTLVLSSLYLVPQIVGAGHLFKLLLG-----WDYTLTVIVSGVLITLLVIIGGM 175 Query: 193 KGTTYVQMIKAVLLVGGVAIMTV-LTFVKVSGGLTTLLNDA---------------VEKH 236 KGTT+ Q I+ ++L+G + ++ + + +G + +++ + K+ Sbjct: 176 KGTTFNQAIQGIVLLGAMLLLLISAAVIYYNGNIFSIITTGKKVVPTVIAAKEAADIVKN 235 Query: 237 AASDYAATKGYDPTQILEPG-LQYGATLTTQLDFISLALALCLGTAGLPHVLMRFYTVPT 295 A AA + PG L G L + +SL L L +G GLPH+L+RFYTV + Sbjct: 236 APDAKAAVEAVRSAMPGAPGALTPGVGLRDFANHLSLVLGLFVGVLGLPHILIRFYTVRS 295 Query: 296 AKEARKSVTWAIVLIGAFYLMTLVLGYGAAALVGPDRV-IAAPG----AANAAAPLLAFE 350 AK A+KS+ + I + FY L +G ++ P+ V + A G A N A P+L Sbjct: 296 AKAAQKSIEFTIWGLAIFYTAVLFVGLAIMYILYPELVDLVASGKRGIATNMAVPMLGQR 355 Query: 351 LGGSIFMALISAVAFATVLAVVAGLAITASAAVGHDIYNAVIRNGQSTEAEQVRVSRITV 410 +GG +F+ LI+A A A +L+ GL ITA+ ++ HD+Y ++ + S E E+V ++ V Sbjct: 356 IGGELFLGLIAAGALAAMLSTCTGLLITATTSIAHDLYASIFKPDSSDE-ERVNFAKKAV 414 Query: 411 VVIGLISIVLGILAMTQNVAFLVALAFAVAASANLPTILYSLYWKKFNTTGAVAAIYTGL 470 +V+ ISI+L I QNV LV ++F +AAS P I+ +++WK+ G V + GL Sbjct: 415 LVLSAISILLAIWLKNQNVGMLVGMSFGIAASTFAPAIVLTVWWKRLTKQGVVIGMAAGL 474 Query: 471 ISALLLIFLSPAVSGNDSAMVPGADWAIFPLKNPGLVSIPLAFIAGWIGTLVGK 524 + +LL F + I L NP L S+P+AF+ + +L+ K Sbjct: 475 LVSLLFTFA--------RFFKLKTLFGIPVLVNPALYSVPVAFLVFIVVSLMTK 520 Lambda K H 0.324 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 624 Number of extensions: 33 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 551 Length of database: 536 Length adjustment: 35 Effective length of query: 516 Effective length of database: 501 Effective search space: 258516 Effective search space used: 258516 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory