Align Propionyl-CoA carboxylase, biotin carboxylase and biotin-carboxyl carrier subunit; PCC; EC 6.4.1.3; EC 6.3.4.14 (characterized)
to candidate WP_089322140.1 CHB58_RS00515 acetyl-CoA carboxylase biotin carboxylase subunit
Query= SwissProt::I3R7G3 (601 letters) >NCBI__GCF_900188395.1:WP_089322140.1 Length = 450 Score = 433 bits (1113), Expect = e-126 Identities = 224/444 (50%), Positives = 309/444 (69%), Gaps = 5/444 (1%) Query: 1 MFSKVLVANRGEIAVRVMRACEELGVRTVAVYSEADKHGGHVRYADEAYNIGPARAADSY 60 MF K+L+ANRGEIAVR++R C+ELG++TVA+YS ADK V ADEA IG + A SY Sbjct: 1 MFKKILIANRGEIAVRIIRTCKELGIKTVAIYSTADKDSLPVFLADEAICIGGEKPASSY 60 Query: 61 LDHESVIEAARKADADAIHPGYGFLAENAEFARKVEDSEFTWVGPSADAMERLGEKTKAR 120 L+ ++I AA + ADAIHPGYGFL+EN FA ++GPS++ M +G+K +AR Sbjct: 61 LNIPAIISAAEISGADAIHPGYGFLSENPGFAEVCRACGIEFIGPSSETMVVMGDKAQAR 120 Query: 121 SLMQDADVPVVPGTTEPADSAEDVKAVADDYGYPVAIKAEGGGGGRGLKVVHSEDEVDGQ 180 S+ + A +P+VPG+ + +AE+ +A + G+PV +KA GGGGRG++++ SE+ Sbjct: 121 SIAKKAGIPIVPGS-DVVKNAEEALQIAKEIGFPVLVKAAHGGGGRGMRIIESEEGAKEL 179 Query: 181 FETAKREGEAYFDNASVYVEKYLEAPRHIEVQILADEHGNVRHLGERDCSLQRRHQKVIE 240 ETA E EA F N VYVEK + PRHIE+Q++AD+HGNV GER+CSLQRRHQKV+E Sbjct: 180 IETAMAEAEAAFGNGEVYVEKLILKPRHIEIQVIADKHGNVIIFGERECSLQRRHQKVLE 239 Query: 241 EAPSPALSEDLRERIGEAARRGVRAAEYTNAGTVEFLV-EDGEFYFMEVNTRIQVEHTVT 299 EAPSP + E+LR+++ EAAR+ + +Y AGTVEFLV ED FYF+E+NTRIQVEH VT Sbjct: 240 EAPSPFVDENLRQKLYEAARKLAQYIKYEGAGTVEFLVDEDKNFYFIEMNTRIQVEHPVT 299 Query: 300 EEVTGLDVVKWQLRVAAGEELDFSQDDVEIEGHSMEFRINAEAPEKEFAPATGTLSTYDP 359 E +TG D++ Q++ A GE+L+ + D E++GH++EFRIN E +K F P G + Sbjct: 300 EMITGKDLIALQIKTAEGEKLEMA--DPELKGHAIEFRINVEDYKKNFRPTPGKVEKLLL 357 Query: 360 PGGIGIRMDDAVRQGDEIGGDYDSMIAKLIVTGSDREEVLVRAERALNEFDIEG-LRTVI 418 PGG G R+D + +G I YDS+IAKLIV G +R + + R +RAL+EF IEG ++T I Sbjct: 358 PGGFGTRVDTHIYEGYTIPPYYDSLIAKLIVHGENRNDAIKRGKRALSEFFIEGNIKTTI 417 Query: 419 PFHRLMLTDEAFREGSHTTKYLDE 442 PFH ++ DE F +G TK L++ Sbjct: 418 PFHLKLIEDENFLKGDLDTKVLED 441 Lambda K H 0.312 0.132 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 664 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 601 Length of database: 450 Length adjustment: 35 Effective length of query: 566 Effective length of database: 415 Effective search space: 234890 Effective search space used: 234890 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory