GapMind for Amino acid biosynthesis

 

Aligments for a candidate for aroB in Shewanella sp. ANA-3

Align 3-dehydroquinate synthase (EC 4.2.3.4) (characterized)
to candidate 7026761 Shewana3_3893 3-dehydroquinate synthase (RefSeq)

Query= BRENDA::P07639
         (362 letters)



>lcl|FitnessBrowser__ANA3:7026761 Shewana3_3893 3-dehydroquinate
           synthase (RefSeq)
          Length = 359

 Score =  429 bits (1102), Expect = e-125
 Identities = 215/358 (60%), Positives = 270/358 (75%), Gaps = 2/358 (0%)

Query: 2   ERIVVTLGERSYPITIASGLFNEPASFLPLKSGEQVMLVTNETLAPLYLDKVRGVLEQAG 61
           ++I V LGERSYPI I   L ++  +       +++++VTNET+APLYL +++  +   G
Sbjct: 3   KQIQVDLGERSYPIYIGQSLMSDGETLSRYLLKKRILIVTNETVAPLYLKQIQDTMASFG 62

Query: 62  VNVDSVILPDGEQYKSLAVLDTVFTALLQKPHGRDTTLVALGGGVVGDLTGFAAASYQRG 121
             V SVILPDGEQ+K L  LD++FTALLQ+ +GRD+ LVALGGGV+GD+TGFAAA YQRG
Sbjct: 63  -EVTSVILPDGEQFKDLTHLDSIFTALLQRNYGRDSVLVALGGGVIGDMTGFAAACYQRG 121

Query: 122 VRFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPASVVVDLDCLKTLPPRELASG 181
           V FIQ+PTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQP  V++D +CL+TLP RE A+G
Sbjct: 122 VDFIQIPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPQIVIIDTECLQTLPAREFAAG 181

Query: 182 LAEVIKYGIILDGAFFNWLEENLDALLRLDGPAMAYCIRRCCELKAEVVAADERETGLRA 241
           +AEVIKYGI+ D  FF WLE N+ AL  LD  A+ Y I RCCE+KA+VV+ DE E G+RA
Sbjct: 182 MAEVIKYGIMWDAEFFQWLENNVQALKSLDTQALVYAISRCCEIKADVVSQDETEQGVRA 241

Query: 242 LLNLGHTFGHAIEAEMGYGNWLHGEAVAAGMVMAARTSERLGQFSSAETQRIITLLKRAG 301
           LLNLGHTFGHAIEAEMGYGNWLHGEAVAAG V+AA+T++ +G    +  +RI+ L     
Sbjct: 242 LLNLGHTFGHAIEAEMGYGNWLHGEAVAAGTVLAAQTAKSMGLIDESIVRRIVQLFHAFD 301

Query: 302 LPVNGPREMSAQAYLPHMLRDKKVLAGEMRLILPLAIGKSEVRSGVSHELVLNAIADC 359
           LPV  P  M   +++ HM RDKKVL G++RL+LP AIG+++V S V  E  L  +  C
Sbjct: 302 LPVTAPESMDFDSFIKHMRRDKKVLGGQIRLVLPTAIGRADVFSQVP-ESTLEQVICC 358


Lambda     K      H
   0.320    0.136    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 342
Number of extensions: 7
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 362
Length of database: 359
Length adjustment: 29
Effective length of query: 333
Effective length of database: 330
Effective search space:   109890
Effective search space used:   109890
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate 7026761 Shewana3_3893 (3-dehydroquinate synthase (RefSeq))
to HMM TIGR01357 (aroB: 3-dehydroquinate synthase (EC 4.2.3.4))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01357.hmm
# target sequence database:        /tmp/gapView.7405.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01357  [M=344]
Accession:   TIGR01357
Description: aroB: 3-dehydroquinate synthase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
     2e-126  407.8   0.0   2.2e-126  407.6   0.0    1.0  1  lcl|FitnessBrowser__ANA3:7026761  Shewana3_3893 3-dehydroquinate s


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__ANA3:7026761  Shewana3_3893 3-dehydroquinate synthase (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  407.6   0.0  2.2e-126  2.2e-126       1     342 [.      14     355 ..      14     357 .. 0.96

  Alignments for each domain:
  == domain 1  score: 407.6 bits;  conditional E-value: 2.2e-126
                         TIGR01357   1 ykvkvgegllkklveelae..kasklvvitdeeveklvaekleealkslgvevlvlvvpdgeesKsletvaklldql 75 
                                       y++++g++l++   e+l++   +++++++t+e+v+ l+ ++++++ +s   ev+ +++pdge+ K+l+++ ++ ++l
  lcl|FitnessBrowser__ANA3:7026761  14 YPIYIGQSLMSDG-ETLSRylLKKRILIVTNETVAPLYLKQIQDTMAS-FGEVTSVILPDGEQFKDLTHLDSIFTAL 88 
                                       6788999888854.5555546679**********************99.77999*********************** PP

                         TIGR01357  76 leeklerksvlvaiGGGvvgDlaGFvAatylRGirlvqvPTtllamvDssvGGKtginlplgkNliGafyqPkaVli 152
                                       l+++  r+svlva+GGGv+gD++GF+Aa y+RG++++q+PTtll++vDssvGGKt++n+plgkN+iGafyqP+ V+i
  lcl|FitnessBrowser__ANA3:7026761  89 LQRNYGRDSVLVALGGGVIGDMTGFAAACYQRGVDFIQIPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPQIVII 165
                                       ***************************************************************************** PP

                         TIGR01357 153 dlkvletlperelreGmaEviKhgliadaelfeelekneklllklaelealeelikrsievKaevVeeDekesglRa 229
                                       d+++l+tlp re+++GmaEviK+g+++dae+f++le+n ++l++l +++al  +i+r++e+Ka+vV++De+e+g+Ra
  lcl|FitnessBrowser__ANA3:7026761 166 DTECLQTLPAREFAAGMAEVIKYGIMWDAEFFQWLENNVQALKSL-DTQALVYAISRCCEIKADVVSQDETEQGVRA 241
                                       ***************************************988765.66***************************** PP

                         TIGR01357 230 lLNfGHtlgHaiEallkyk.lsHGeaVaiGmvveaklseklgllkaellerlvallkklglptklkkklsveellka 305
                                       lLN+GHt+gHaiEa+++y+ + HGeaVa G v++a++++++gl+++++++r+v+l++++ lp++ ++++++++++k+
  lcl|FitnessBrowser__ANA3:7026761 242 LLNLGHTFGHAIEAEMGYGnWLHGEAVAAGTVLAAQTAKSMGLIDESIVRRIVQLFHAFDLPVTAPESMDFDSFIKH 318
                                       ***************************************************************************** PP

                         TIGR01357 306 llkDKKnegskiklvlleeiGkaalasevteeellea 342
                                       + +DKK  g++i+lvl+++iG+a + s+v+e++l ++
  lcl|FitnessBrowser__ANA3:7026761 319 MRRDKKVLGGQIRLVLPTAIGRADVFSQVPESTLEQV 355
                                       **************************9*999888775 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (344 nodes)
Target sequences:                          1  (359 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 9.14
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory