GapMind for Amino acid biosynthesis


Aligments for a candidate for asp-kinase in Shewanella sp. ANA-3

Align fused aspartate kinase/homoserine dehydrogenase 2 (EC; EC (characterized)
to candidate 7026471 Shewana3_3613 bifunctional aspartate kinase II/homoserine dehydrogenase II (RefSeq)

         (810 letters)

>lcl|FitnessBrowser__ANA3:7026471 Shewana3_3613 bifunctional
           aspartate kinase II/homoserine dehydrogenase II (RefSeq)
          Length = 797

 Score =  563 bits (1451), Expect = e-164
 Identities = 340/802 (42%), Positives = 472/802 (58%), Gaps = 22/802 (2%)

           LHKFGGSSLAD  CY RVA I+  +   DD++VVSAAG TTN L   L L  +++L   +

           +Q  L  YQ  LI  LL  E+A  L     +D  +L +LL     ND   + VV  GE W

           SARLM+A+L + G+ A+ +DA   L A+ AA PQ+    S   +Q LL  HP +RLV+TG

           FI  N  G+T+LLGRNGSD+SA+ I +LA + RVTIW+DV GV++ADP K+ DA LL  +

            L EA  LARL +PVLH+RTLQP+  +E+ L +R SY      T I    +S   A +VT

           + + V L  F++       L        L  A + PLA  + +  Q L+  YT+E     

            K+LD   EA    +L++   L LVA+V A       H  R + +L  +  +  +  D  

           +SLV ++       L Q +H+      KRIG++L G GNIG  W++LF     +L+    

               L G+V S ++L+    +D       F+ EA     E LF  +     D+L+ LD++

           AS  L  QY +F   G H++SANKLAG+     YR++ +        W YNA+ GAGLPI

            H + DL +SGD++ ++ GIFSGTL WLF ++D S PF+ELV +A   G+TEPDPRDDLS

           G+D+ RKL+ILARE G  IE + + + SLVPAH     ++ F     EL++++ Q+  AA

            E   VLRYVA  D +G   KA VG++ +  +HP A+L P DNVF I S +Y+ NPL+IR

           GPGAGR+VTA A+QSD+ ++ +

Lambda     K      H
   0.320    0.135    0.397 

Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1491
Number of extensions: 63
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 810
Length of database: 797
Length adjustment: 41
Effective length of query: 769
Effective length of database: 756
Effective search space:   581364
Effective search space used:   581364
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 55 (25.8 bits)

Align candidate 7026471 Shewana3_3613 (bifunctional aspartate kinase II/homoserine dehydrogenase II (RefSeq))
to HMM TIGR00657 (aspartate kinase (EC

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020);
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00657.hmm
# target sequence database:        /tmp/gapView.23104.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00657  [M=442]
Accession:   TIGR00657
Description: asp_kinases: aspartate kinase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
      1e-67  215.1   0.0    1.6e-67  214.5   0.0    1.2  1  lcl|FitnessBrowser__ANA3:7026471  Shewana3_3613 bifunctional aspar

Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__ANA3:7026471  Shewana3_3613 bifunctional aspartate kinase II/homoserine dehydrogenase II (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  214.5   0.0   1.6e-67   1.6e-67       6     438 ..       7     431 ..       4     434 .. 0.83

  Alignments for each domain:
  == domain 1  score: 214.5 bits;  conditional E-value: 1.6e-67
                         TIGR00657   6 qKFGGtSvgnverikkvakivkkekekgnqvvVVvSAmagvTdaLvelaekvsseee.keliekirekhlealeela 81 
                                        KFGG+S+++++  ++va+i++ + ++  + +VVvSA +++T+ L +l +  +s++  +e+++++ + +   +e+l 
                                       6*******************9999855..589************************998888888777777777777 PP

                         TIGR00657  82 .sqalkeklkallekeleevkk.......ereldlilsvGEklSaallaaaleelgvkavsllgaeagiltdsefgr 150
                                        +++ +   ++l+  + +++         + +   ++s+GE+ Sa+l+aa+l+e g  a+s ++a + +++d++   
                                       45444444444444444444448888888888999*********************.77888888888888776555 PP

                         TIGR00657 151 Akvleeikterleklleeg..iivvvaGFiGatekgeittLGRGGSDltAallAaalkAdeveiytDVdGiytaDPr 225
                                           +++++ ++++ll +      v++GFi a+e g++ +LGR+GSD++A+l+A++ + ++v i+tDV+G++ aDP+
                                       44.677777777777777666899***************************************************** PP

                         TIGR00657 226 ivpeArrldeisyeEalELaslGakvLhprtlepamrakipivvkstfnpeaeGTlivakskseeepavkalsldkn 302
                                       ++++A++l+++s +Ea  La+lG+ vLh rtl+p+ + ++ + v+s++  +++ Tli ++s+s ++p v+   + + 
                                       ************************************************************8866655554...4444 PP

                         TIGR00657 303 qalvsvsgttmkpgilaevfgalaeakvnvdlilqsssetsisfvvdkedadkakellkkkvkeekaleevevekkl 379
                                        +l+  +++    g +a ++++l ea+    +  +s++ + ++++   e+ ++ ++ll ++  e+  +++++++++l
                                       455544444....5568888889999999988887777.478*************998.5688888999******** PP

                         TIGR00657 380 alvslvGagmksapgvaakifeaLaeeniniemissseikisvvvdekdaekavealhe 438
                                        lv+lv+a+ +++    a++++  a+       + s + +++++v++++++ +++++h+
                                       ***********988887777766555......344577888888888888888888886 PP

Internal pipeline statistics summary:
Query model(s):                            1  (442 nodes)
Target sequences:                          1  (797 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 12.13

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.



Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory