Align Histidinol-phosphate aminotransferase; Imidazole acetol-phosphate transaminase; HPAT; HspAT; EC 2.6.1.9 (characterized)
to candidate 7024674 Shewana3_1852 histidinol phosphate aminotransferase (RefSeq)
Query= SwissProt::P06986 (356 letters) >lcl|FitnessBrowser__ANA3:7024674 Shewana3_1852 histidinol phosphate aminotransferase (RefSeq) Length = 401 Score = 303 bits (775), Expect = 7e-87 Identities = 165/359 (45%), Positives = 227/359 (63%), Gaps = 9/359 (2%) Query: 3 TVTITDLARENVRNLTPYQSARRLGGNGDVWLNANEYP--TAVEFQLTQQTLNRYPECQP 60 T LAR + LTPYQSARRLGG GD+W+NANE P +L LNRYPECQP Sbjct: 47 TTLAARLARPELLELTPYQSARRLGGRGDIWINANESPFNNVAVAELDLSKLNRYPECQP 106 Query: 61 KAVIENYAQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSVSAETI 120 A+I Y+QY+GV +++ SRGADE IELLIRAFC PG D+I PTYGMY++SA+T Sbjct: 107 PALINAYSQYSGVVESKIVASRGADEAIELLIRAFCVPGIDSIATFGPTYGMYAISAQTF 166 Query: 121 GVECRTVPTLDNWQLDLQGISDKLDGVKVVYVCSPNNPTGQLINPQDFRTLLELTRGKAI 180 V + + + L + G K+V++C+PNNPTG +I+ ++ AI Sbjct: 167 NVGVKALSLTAEYGLPAD-FATAARGAKLVFICNPNNPTGTVIDKARIEQAIQALPD-AI 224 Query: 181 VVADEAYIEFCPQASLAGWLAEYPHLAILRTLSKAFALAGLRCGFTLANEEVINLLMKVI 240 VV DEAYIEFCP+ S+A L YP+L +LRTLSKAFALAG RCGF LANEE+I ++M+VI Sbjct: 225 VVVDEAYIEFCPEYSVADLLESYPNLVVLRTLSKAFALAGARCGFLLANEEIIEIIMRVI 284 Query: 241 APYPLSTPVADIAAQALSPQGIVAMRERVAQIIAEREYLIAALKEIPCVE---QVFDSET 297 APYP+ PV+++A QALS GI M+ +V ++ A+ E L AAL + C + V Sbjct: 285 APYPVPLPVSEVAVQALSAAGIARMKTQVKELNAQGERLAAAL-NLYCEQWGGAVLTPNG 343 Query: 298 NYILARFKASSAVFKSLWDQGIILRDQNKQPSLSGCLRITVGTREESQRVIDALRAEQV 356 NY+LA F + V + L D GI+ R K P L+ +R + ++ ++ R++ ++++ Sbjct: 344 NYVLAEFDDVAKVAQLLIDNGIVAR-AYKDPRLAKAIRFSFSSQADTDRLVSLFESQKL 401 Lambda K H 0.319 0.135 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 413 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 401 Length adjustment: 30 Effective length of query: 326 Effective length of database: 371 Effective search space: 120946 Effective search space used: 120946 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate 7024674 Shewana3_1852 (histidinol phosphate aminotransferase (RefSeq))
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.21569.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-101 323.8 0.0 6.8e-101 323.6 0.0 1.0 1 lcl|FitnessBrowser__ANA3:7024674 Shewana3_1852 histidinol phospha Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__ANA3:7024674 Shewana3_1852 histidinol phosphate aminotransferase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 323.6 0.0 6.8e-101 6.8e-101 1 347 [. 55 397 .. 55 399 .. 0.94 Alignments for each domain: == domain 1 score: 323.6 bits; conditional E-value: 6.8e-101 TIGR01141 1 rekikklepYqpgarelgekevvkLnsnEnPfgpsekvkealkeelkklhrYpdpqalelkealakylgveeenill 77 r+++ +l+pYq+ ar+lg+ ++++ n+nE+Pf++ ++++l l+kl+rYp++q+ +l +a+++y gv e +i++ lcl|FitnessBrowser__ANA3:7024674 55 RPELLELTPYQS-ARRLGGRGDIWINANESPFNNV--AVAEL--DLSKLNRYPECQPPALINAYSQYSGVVESKIVA 126 678999******.9*******************99..56666..455****************************** PP TIGR01141 78 gnGsdelielliraflepg.davlvleptysmYevsakiagaevkevplkedgqedleavleaakekvklvflasPn 153 ++G+de+ielliraf+ pg d+++++ pty mY++sa++ ++ vk +l+++ ++++ +a++ +klvf+++Pn lcl|FitnessBrowser__ANA3:7024674 127 SRGADEAIELLIRAFCVPGiDSIATFGPTYGMYAISAQTFNVGVKALSLTAE-YGLPADFA-TAARGAKLVFICNPN 201 ****************************************************.46777777.8999*********** PP TIGR01141 154 nPtGnllkreeiekvleevedalVVvDeAYieFseeasvlellaeypnlvvlrTlSKafgLAglRvGyaianaeiie 230 nPtG++++++ ie+ +++ da+VVvDeAYieF++e+sv++ll+ ypnlvvlrTlSKaf+LAg R+G+++an+eiie lcl|FitnessBrowser__ANA3:7024674 202 NPTGTVIDKARIEQAIQALPDAIVVVDEAYIEFCPEYSVADLLESYPNLVVLRTLSKAFALAGARCGFLLANEEIIE 278 ******************99********************************************************* PP TIGR01141 231 alekvrapynvsslaleaavaalrdsd..kiektveevkkererlleelkklegle...vyeSkaNFvlikvkedae 302 ++++v+apy+v+ +++e+av+al+ + ++ +v+e++++ erl ++l+ ++ v ++N+vl++++ d + lcl|FitnessBrowser__ANA3:7024674 279 IIMRVIAPYPVPLPVSEVAVQALSAAGiaRMKTQVKELNAQGERLAAALNLYCEQWggaVLTPNGNYVLAEFD-DVA 354 **************************9999*******************97753322348889*********9.*** PP TIGR01141 303 elleallekgiivRdlksaeglleeclRitvGtreenerllealk 347 ++++ l+++gi+ R k + l +++R + ++ +++rl+ ++ lcl|FitnessBrowser__ANA3:7024674 355 KVAQLLIDNGIVARAYKD--PRLAKAIRFSFSSQADTDRLVSLFE 397 ****************94..468****************998876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (401 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 13.17 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory