Align Histidinol-phosphate aminotransferase; Imidazole acetol-phosphate transaminase; HPAT; HspAT; EC 2.6.1.9 (characterized)
to candidate 7024674 Shewana3_1852 histidinol phosphate aminotransferase (RefSeq)
Query= SwissProt::P06986 (356 letters) >FitnessBrowser__ANA3:7024674 Length = 401 Score = 303 bits (775), Expect = 7e-87 Identities = 165/359 (45%), Positives = 227/359 (63%), Gaps = 9/359 (2%) Query: 3 TVTITDLARENVRNLTPYQSARRLGGNGDVWLNANEYP--TAVEFQLTQQTLNRYPECQP 60 T LAR + LTPYQSARRLGG GD+W+NANE P +L LNRYPECQP Sbjct: 47 TTLAARLARPELLELTPYQSARRLGGRGDIWINANESPFNNVAVAELDLSKLNRYPECQP 106 Query: 61 KAVIENYAQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSVSAETI 120 A+I Y+QY+GV +++ SRGADE IELLIRAFC PG D+I PTYGMY++SA+T Sbjct: 107 PALINAYSQYSGVVESKIVASRGADEAIELLIRAFCVPGIDSIATFGPTYGMYAISAQTF 166 Query: 121 GVECRTVPTLDNWQLDLQGISDKLDGVKVVYVCSPNNPTGQLINPQDFRTLLELTRGKAI 180 V + + + L + G K+V++C+PNNPTG +I+ ++ AI Sbjct: 167 NVGVKALSLTAEYGLPAD-FATAARGAKLVFICNPNNPTGTVIDKARIEQAIQALPD-AI 224 Query: 181 VVADEAYIEFCPQASLAGWLAEYPHLAILRTLSKAFALAGLRCGFTLANEEVINLLMKVI 240 VV DEAYIEFCP+ S+A L YP+L +LRTLSKAFALAG RCGF LANEE+I ++M+VI Sbjct: 225 VVVDEAYIEFCPEYSVADLLESYPNLVVLRTLSKAFALAGARCGFLLANEEIIEIIMRVI 284 Query: 241 APYPLSTPVADIAAQALSPQGIVAMRERVAQIIAEREYLIAALKEIPCVE---QVFDSET 297 APYP+ PV+++A QALS GI M+ +V ++ A+ E L AAL + C + V Sbjct: 285 APYPVPLPVSEVAVQALSAAGIARMKTQVKELNAQGERLAAAL-NLYCEQWGGAVLTPNG 343 Query: 298 NYILARFKASSAVFKSLWDQGIILRDQNKQPSLSGCLRITVGTREESQRVIDALRAEQV 356 NY+LA F + V + L D GI+ R K P L+ +R + ++ ++ R++ ++++ Sbjct: 344 NYVLAEFDDVAKVAQLLIDNGIVAR-AYKDPRLAKAIRFSFSSQADTDRLVSLFESQKL 401 Lambda K H 0.319 0.135 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 413 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 401 Length adjustment: 30 Effective length of query: 326 Effective length of database: 371 Effective search space: 120946 Effective search space used: 120946 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate 7024674 Shewana3_1852 (histidinol phosphate aminotransferase (RefSeq))
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.25602.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-101 323.8 0.0 6.8e-101 323.6 0.0 1.0 1 lcl|FitnessBrowser__ANA3:7024674 Shewana3_1852 histidinol phospha Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__ANA3:7024674 Shewana3_1852 histidinol phosphate aminotransferase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 323.6 0.0 6.8e-101 6.8e-101 1 347 [. 55 397 .. 55 399 .. 0.94 Alignments for each domain: == domain 1 score: 323.6 bits; conditional E-value: 6.8e-101 TIGR01141 1 rekikklepYqpgarelgekevvkLnsnEnPfgpsekvkealkeelkklhrYpdpqalelkealakylgveeenill 77 r+++ +l+pYq+ ar+lg+ ++++ n+nE+Pf++ ++++l l+kl+rYp++q+ +l +a+++y gv e +i++ lcl|FitnessBrowser__ANA3:7024674 55 RPELLELTPYQS-ARRLGGRGDIWINANESPFNNV--AVAEL--DLSKLNRYPECQPPALINAYSQYSGVVESKIVA 126 678999******.9*******************99..56666..455****************************** PP TIGR01141 78 gnGsdelielliraflepg.davlvleptysmYevsakiagaevkevplkedgqedleavleaakekvklvflasPn 153 ++G+de+ielliraf+ pg d+++++ pty mY++sa++ ++ vk +l+++ ++++ +a++ +klvf+++Pn lcl|FitnessBrowser__ANA3:7024674 127 SRGADEAIELLIRAFCVPGiDSIATFGPTYGMYAISAQTFNVGVKALSLTAE-YGLPADFA-TAARGAKLVFICNPN 201 ****************************************************.46777777.8999*********** PP TIGR01141 154 nPtGnllkreeiekvleevedalVVvDeAYieFseeasvlellaeypnlvvlrTlSKafgLAglRvGyaianaeiie 230 nPtG++++++ ie+ +++ da+VVvDeAYieF++e+sv++ll+ ypnlvvlrTlSKaf+LAg R+G+++an+eiie lcl|FitnessBrowser__ANA3:7024674 202 NPTGTVIDKARIEQAIQALPDAIVVVDEAYIEFCPEYSVADLLESYPNLVVLRTLSKAFALAGARCGFLLANEEIIE 278 ******************99********************************************************* PP TIGR01141 231 alekvrapynvsslaleaavaalrdsd..kiektveevkkererlleelkklegle...vyeSkaNFvlikvkedae 302 ++++v+apy+v+ +++e+av+al+ + ++ +v+e++++ erl ++l+ ++ v ++N+vl++++ d + lcl|FitnessBrowser__ANA3:7024674 279 IIMRVIAPYPVPLPVSEVAVQALSAAGiaRMKTQVKELNAQGERLAAALNLYCEQWggaVLTPNGNYVLAEFD-DVA 354 **************************9999*******************97753322348889*********9.*** PP TIGR01141 303 elleallekgiivRdlksaeglleeclRitvGtreenerllealk 347 ++++ l+++gi+ R k + l +++R + ++ +++rl+ ++ lcl|FitnessBrowser__ANA3:7024674 355 KVAQLLIDNGIVARAYKD--PRLAKAIRFSFSSQADTDRLVSLFE 397 ****************94..468****************998876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (401 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 13.28 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory