Align Aspartate-semialdehyde dehydrogenase 2; ASA dehydrogenase 2; ASADH 2; Aspartate-beta-semialdehyde dehydrogenase 2; EC 1.2.1.11 (characterized)
to candidate 7024285 Shewana3_1477 aspartate semialdehyde dehydrogenase (RefSeq)
Query= SwissProt::P23247 (337 letters) >FitnessBrowser__ANA3:7024285 Length = 338 Score = 481 bits (1239), Expect = e-141 Identities = 236/338 (69%), Positives = 271/338 (80%), Gaps = 1/338 (0%) Query: 1 MSQQFNVAIFGATGAVGETMLEVLQEREFPVDELFLLASERSEGKTYRFNGKTVRVQNVE 60 MSQ+FNV + GA+GAVG+TM+E+L+ER FPV L+ LAS RS G+T F+GK V + +VE Sbjct: 1 MSQEFNVVVLGASGAVGQTMIEILEERNFPVANLYPLASSRSAGETVSFHGKQVTILDVE 60 Query: 61 EFDWSQVHIALFSAGGELSAKWAPIAAEAGVVVIDNTSHFRYDYDIPLVVPEVNPEAIAE 120 FDWSQ + FSAGG++SAKWAPIAAEAG VVIDNTSHFRYD DIPLVVPEVNP AIA+ Sbjct: 61 TFDWSQAQLGFFSAGGDVSAKWAPIAAEAGCVVIDNTSHFRYDIDIPLVVPEVNPHAIAD 120 Query: 121 FRNRNIIANPNCSTIQMLVALKPIYDAVGIERINVTTYQSVSGAGKAGIDELAGQTAKLL 180 FRNRNIIANPNCSTIQMLVALKPIYD GI RINV TYQSVSG GK I+ELA Q KLL Sbjct: 121 FRNRNIIANPNCSTIQMLVALKPIYDTYGISRINVATYQSVSGTGKKAIEELAKQCTKLL 180 Query: 181 NGYPAETNTFSQQIAFNCIPQIDQFMDNGYTKEEMKMVWETQKIFNDPSIMVNPTCVRVP 240 G PA+ + +QIAFN +PQID+FMDNGYTKEEMKMVWETQKIF D I+VN T VRVP Sbjct: 181 QGLPADAEVYPKQIAFNVLPQIDKFMDNGYTKEEMKMVWETQKIFGDDEILVNATAVRVP 240 Query: 241 VFYGHAEAVHVETRAPIDAEQVMDMLEQTDGIELFRGAD-FPTQVRDAGGKDHVLVGRVR 299 VFYGH+EAVH+ETR P DAE + +L +G+ LF D +PT V A G D V VGRVR Sbjct: 241 VFYGHSEAVHIETRQPADAEDIKALLRDAEGVVLFESDDEYPTAVTHAAGTDPVYVGRVR 300 Query: 300 NDISHHSGINLWVVADNVRKGAATNAVQIAELLVRDYF 337 DISH GINLWVV+DN+RKGAA N+VQIAE+LVRDY+ Sbjct: 301 KDISHSHGINLWVVSDNIRKGAALNSVQIAEILVRDYY 338 Lambda K H 0.319 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 338 Length adjustment: 28 Effective length of query: 309 Effective length of database: 310 Effective search space: 95790 Effective search space used: 95790 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate 7024285 Shewana3_1477 (aspartate semialdehyde dehydrogenase (RefSeq))
to HMM TIGR01296 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01296.hmm # target sequence database: /tmp/gapView.22157.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01296 [M=339] Accession: TIGR01296 Description: asd_B: aspartate-semialdehyde dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.4e-137 442.1 0.1 7.2e-137 441.9 0.1 1.0 1 lcl|FitnessBrowser__ANA3:7024285 Shewana3_1477 aspartate semialde Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__ANA3:7024285 Shewana3_1477 aspartate semialdehyde dehydrogenase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 441.9 0.1 7.2e-137 7.2e-137 1 338 [. 6 335 .. 6 336 .. 0.98 Alignments for each domain: == domain 1 score: 441.9 bits; conditional E-value: 7.2e-137 TIGR01296 1 nvaivGatGavGqellkvLeernfpidklvllasersaGkkvkfkgkeleveeaekesfegidialfsaGgsvskef 77 nv ++Ga+GavGq+++++Leernfp+ +l++las+rsaG+ v f+gk++++ ++e+++ ++ ++ +fsaGg vs ++ lcl|FitnessBrowser__ANA3:7024285 6 NVVVLGASGAVGQTMIEILEERNFPVANLYPLASSRSAGETVSFHGKQVTILDVETFDWSQAQLGFFSAGGDVSAKW 82 689************************************************************************** PP TIGR01296 78 apkaakagviviDntsafrldedvPLvvpevnaeelkeakkkgiianPnCstiqlvvvLkplkdeaklkrvvvstYq 154 ap aa+ag++viDnts fr d d+PLvvpevn + ++++++++iianPnCstiq++v+Lkp++d +++ r+ v+tYq lcl|FitnessBrowser__ANA3:7024285 83 APIAAEAGCVVIDNTSHFRYDIDIPLVVPEVNPHAIADFRNRNIIANPNCSTIQMLVALKPIYDTYGISRINVATYQ 159 ***************************************************************************** PP TIGR01296 155 avsGaGkkgveeLknqtkavlegkekepeidalkakkfakqiafnaiplidklkedGytkeelkllfetrkilgied 231 +vsG+Gkk++eeL++q l+g + a+ ++kqiafn++p+idk++++Gytkee+k+++et+ki+g+++ lcl|FitnessBrowser__ANA3:7024285 160 SVSGTGKKAIEELAKQCTKLLQGLPAD-------AEVYPKQIAFNVLPQIDKFMDNGYTKEEMKMVWETQKIFGDDE 229 *****************9999988776.......799**************************************** PP TIGR01296 232 lkvsatcvrvPvftghsesvsiefekelsveevkelLkeapgvvviddpsenlyptPl.eavgkdevfvgrirkDls 307 + v at+vrvPvf+ghse+v+ie+ +++++e++k lL++a+gvv+ + + ++ypt + +a+g+d v+vgr+rkD+s lcl|FitnessBrowser__ANA3:7024285 230 ILVNATAVRVPVFYGHSEAVHIETRQPADAEDIKALLRDAEGVVLFESD--DEYPTAVtHAAGTDPVYVGRVRKDIS 304 *********************************************9977..89**9973699*************** PP TIGR01296 308 kekglalfvvaDnlrkGaalnavqiaellik 338 +++g++l+vv+Dn+rkGaaln+vqiae l++ lcl|FitnessBrowser__ANA3:7024285 305 HSHGINLWVVSDNIRKGAALNSVQIAEILVR 335 ****************************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (339 nodes) Target sequences: 1 (338 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.33 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory