Align Homoserine O-succinyltransferase; HST; Homoserine transsuccinylase; HTS; EC 2.3.1.46 (characterized)
to candidate 7025621 Shewana3_2772 homoserine O-succinyltransferase (RefSeq)
Query= SwissProt::A6WLE9 (313 letters) >FitnessBrowser__ANA3:7025621 Length = 313 Score = 613 bits (1580), Expect = e-180 Identities = 290/313 (92%), Positives = 306/313 (97%) Query: 1 MPVRIPDHLPAAEVLESENIFVMSETRAANQDIRPMKVLILNLMPNKIETETQLLRLLGN 60 MPV+IPDHLPAA +LESENIFVMSETRAANQDIRPMKVLILNLMPNKIETETQLLRLLGN Sbjct: 1 MPVKIPDHLPAAGILESENIFVMSETRAANQDIRPMKVLILNLMPNKIETETQLLRLLGN 60 Query: 61 TPLQVDVDLLRIHDKESKHTSIDHMNTFYRDFEAVRHKNYDGLIITGAPLGQIDFEDVVY 120 TPLQVDVDLLRIHDKESKHTSIDHMNTFYRDFE VRHKNYDGLIITGAPLGQIDFE+V Y Sbjct: 61 TPLQVDVDLLRIHDKESKHTSIDHMNTFYRDFEDVRHKNYDGLIITGAPLGQIDFEEVTY 120 Query: 121 WDHIREIIDWSQEHVTSVLFLCWAAHAGLYHLYGLNRKILQQKRSGVFVHRRTSQHFPLL 180 WDHIREIIDWSQ+HVTSVLFLCWAAHAGLYHLYGLNRKILQQKRSGVFVHRRT QHFPLL Sbjct: 121 WDHIREIIDWSQQHVTSVLFLCWAAHAGLYHLYGLNRKILQQKRSGVFVHRRTCQHFPLL 180 Query: 181 RGFDDEFFAPHSRFAEMDVEEIRQHPQLQLLAESDEAGAYLVLSRNNRNLFVMGHPEYQK 240 RGFDDEFFAPHSRFAEMD+EE++QH +LQ+LA+SDEAGAYLVLSRNNRNLFVMGHPEYQK Sbjct: 181 RGFDDEFFAPHSRFAEMDIEELKQHSELQVLAQSDEAGAYLVLSRNNRNLFVMGHPEYQK 240 Query: 241 STLNEEYQRDLSQGLDPNVPQNYYRNDDPKADAIARWHSHGSLLVSNWLNYYVYQLTPYD 300 STLN+EY RDL+QGL+PNVPQNYYRNDDPK DAIARWHSHGSLLVSNWLNYYVYQLTPYD Sbjct: 241 STLNDEYHRDLAQGLNPNVPQNYYRNDDPKDDAIARWHSHGSLLVSNWLNYYVYQLTPYD 300 Query: 301 LSDMTAMTPWESR 313 LSDM+A+TPWES+ Sbjct: 301 LSDMSAVTPWESQ 313 Lambda K H 0.321 0.136 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 500 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 313 Length adjustment: 27 Effective length of query: 286 Effective length of database: 286 Effective search space: 81796 Effective search space used: 81796 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate 7025621 Shewana3_2772 (homoserine O-succinyltransferase (RefSeq))
to HMM TIGR01001 (metA: homoserine O-succinyltransferase (EC 2.3.1.46))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01001.hmm # target sequence database: /tmp/gapView.12764.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01001 [M=301] Accession: TIGR01001 Description: metA: homoserine O-succinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-144 466.9 0.6 2e-144 466.7 0.6 1.0 1 lcl|FitnessBrowser__ANA3:7025621 Shewana3_2772 homoserine O-succi Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__ANA3:7025621 Shewana3_2772 homoserine O-succinyltransferase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 466.7 0.6 2e-144 2e-144 1 300 [. 1 301 [. 1 302 [. 0.99 Alignments for each domain: == domain 1 score: 466.7 bits; conditional E-value: 2e-144 TIGR01001 1 mpirvpdelpavellkeenifvmtekrashqdirplevlilnlmpkkietenqllrllsnsplqvditllridsrks 77 mp+++pd+lpa +l+ enifvm+e ra +qdirp++vlilnlmp+kiete+qllrll+n+plqvd++llri++++s lcl|FitnessBrowser__ANA3:7025621 1 MPVKIPDHLPAAGILESENIFVMSETRAANQDIRPMKVLILNLMPNKIETETQLLRLLGNTPLQVDVDLLRIHDKES 77 9**************************************************************************** PP TIGR01001 78 kntpiehlekfykeleevkdrkfdGlivtGapvellefedvayweelkeilewskenvtstlyicwaaqaalkllyg 154 k+t i+h+++fy+++e+v+++++dGli+tGap+++++fe+v yw++++ei++ws+++vts l++cwaa+a+l+ lyg lcl|FitnessBrowser__ANA3:7025621 78 KHTSIDHMNTFYRDFEDVRHKNYDGLIITGAPLGQIDFEEVTYWDHIREIIDWSQQHVTSVLFLCWAAHAGLYHLYG 154 ***************************************************************************** PP TIGR01001 155 ipkrtleeklsGvykhdiv.kedlllrgfddkflaphsryadldeeliaeltdleilaesdeagvylaaskdernif 230 ++++ l++k sGv+ h+ + ++ +llrgfdd+f+aphsr+a++d e+++++++l++la+sdeag+yl++s+++rn+f lcl|FitnessBrowser__ANA3:7025621 155 LNRKILQQKRSGVFVHRRTcQHFPLLRGFDDEFFAPHSRFAEMDIEELKQHSELQVLAQSDEAGAYLVLSRNNRNLF 231 *****************9978999***************************************************** PP TIGR01001 231 vtGhpeydketlrqeyvrdvgeglkvdipknyypkddpektpiaswrshanllfanwlnyavyqktpydl 300 v+Ghpey+k tl++ey rd+ +gl++++p+nyy +ddp++ ia w+sh+ ll +nwlny+vyq tpydl lcl|FitnessBrowser__ANA3:7025621 232 VMGHPEYQKSTLNDEYHRDLAQGLNPNVPQNYYRNDDPKDDAIARWHSHGSLLVSNWLNYYVYQLTPYDL 301 ********************************************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (301 nodes) Target sequences: 1 (313 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 9.97 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory