Align cystathionine gamma-synthase (EC 2.5.1.48) (characterized)
to candidate 7025489 Shewana3_2643 methionine gamma-lyase (RefSeq)
Query= BRENDA::Q1M0P5 (380 letters) >FitnessBrowser__ANA3:7025489 Length = 397 Score = 309 bits (791), Expect = 1e-88 Identities = 172/386 (44%), Positives = 236/386 (61%), Gaps = 11/386 (2%) Query: 5 TKLIHGGISEDATTGAVSVPIYQTSTYRQDAI--------GHHKGYEYSRSGNPTRFALE 56 T+ IH G +A G + P+YQT+T+ ++ G+ GY Y+R GNPT LE Sbjct: 13 TQAIHAGHEREAF-GTLVTPLYQTATFVFESAQQGGERFAGNEPGYIYTRLGNPTVAELE 71 Query: 57 ELIADLEGGVKGFAFASGLAGIHA-VFSLLQSGDHVLLGDDVYGGTFRLFNKVLVKNGLS 115 +A LEG A ASG+ + A + + LQ GDH++ + VYG TF L + G+ Sbjct: 72 RKMAILEGAEAAAATASGMGAVSAALLANLQMGDHLVASNAVYGCTFALMTSQFARFGIE 131 Query: 116 CTIIDTSDLSQIKKAIKPNTKALYLETPSNPLLKITDLAQCASVAKDHGLLTIVDNTFAT 175 T++D +DL+ I++AIKPNT+ ++ ETP NP L++ DL A +AK H L++IVDNTF T Sbjct: 132 VTLVDFTDLAAIERAIKPNTRVIFCETPVNPHLQVFDLKGIADIAKRHQLVSIVDNTFMT 191 Query: 176 PYYQNPLLLGADIVVHSGTKYLGGHSDVVAGLVTTNNEALAQEIAFFQNAIGGVLGPQDS 235 P Q PL G D+VVHS TKYL GH DV+AG+V + E L + IG V+ P D+ Sbjct: 192 PLLQQPLAFGIDLVVHSATKYLNGHGDVIAGVVCGSEEQLHRVKYEILKDIGAVMSPHDA 251 Query: 236 WLLQRGIKTLGLRMQAHQKNALCVAEFLEKHPKVERVYYPGLPTHPNYELAKKQMRGFSG 295 WL+ RG+KTL +R+Q H +A VAEFLE+HP V RVYYPGL +H + QM G Sbjct: 252 WLILRGLKTLDVRLQRHCDSAQRVAEFLEQHPAVTRVYYPGLKSHSGHRFIGGQMAKAGG 311 Query: 296 MLSFTLKNDSE-ATPFVESLKLFILGESLGGVESLVGVPAFMTHACIPKTQREAAGIRDG 354 +++F L E A FV LKLF + SLG ESL+ PA MTH+ R+AAGI D Sbjct: 312 VIAFELAASLEQAMAFVGYLKLFSIAVSLGDAESLIQHPASMTHSPYTPEARQAAGISDN 371 Query: 355 LVRLSVGIEHEQDLLEDLEQAFAKIS 380 L+R+S+G+E D++EDL QA A ++ Sbjct: 372 LLRISIGLEDCGDIIEDLNQALAMLA 397 Lambda K H 0.318 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 389 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 397 Length adjustment: 30 Effective length of query: 350 Effective length of database: 367 Effective search space: 128450 Effective search space used: 128450 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory