Align O-acetylhomoserine sulfhydrylase (EC:2.5.1.49) (characterized)
to candidate 7025489 Shewana3_2643 methionine gamma-lyase (RefSeq)
Query= reanno::Korea:Ga0059261_3194 (402 letters) >FitnessBrowser__ANA3:7025489 Length = 397 Score = 339 bits (869), Expect = 1e-97 Identities = 178/393 (45%), Positives = 248/393 (63%), Gaps = 3/393 (0%) Query: 7 QDRSITQNWKPATQAIRGGTARSEWGETSEALFLTSGYAYDCAGDAAARFSGDQQGMTYS 66 QD S Q WK ATQAI G R +G L+ T+ + ++ A RF+G++ G Y+ Sbjct: 2 QDESSKQ-WKAATQAIHAGHEREAFGTLVTPLYQTATFVFESAQQGGERFAGNEPGYIYT 60 Query: 67 RLQNPTVEMLEQRIALLEGAEACRATASGMAAMTAALLCQLSAGDHLIGGRAAFGSCRWL 126 RL NPTV LE+++A+LEGAEA ATASGM A++AALL L GDHL+ A +G L Sbjct: 61 RLGNPTVAELERKMAILEGAEAAAATASGMGAVSAALLANLQMGDHLVASNAVYGCTFAL 120 Query: 127 TDTQLPKFGIETTVVDARDPQQFIDAIRPNTKVFFFETPANPTMDVVDLKAVCAIARERG 186 +Q +FGIE T+VD D AI+PNT+V F ETP NP + V DLK + IA+ Sbjct: 121 MTSQFARFGIEVTLVDFTDLAAIERAIKPNTRVIFCETPVNPHLQVFDLKGIADIAKRHQ 180 Query: 187 IVTVVDNAFATPALQRPMDFGADVVAYSATKMMDGQGRVLAGAVCGTEEFINNTLLPFHR 246 +V++VDN F TP LQ+P+ FG D+V +SATK ++G G V+AG VCG+EE ++ + Sbjct: 181 LVSIVDNTFMTPLLQQPLAFGIDLVVHSATKYLNGHGDVIAGVVCGSEEQLHRVKYEILK 240 Query: 247 NTGPTLSPFNAWVVLKGLETLDLRIQRQSENALKVARFLEGR--VPRVNFPGLPSHPQHN 304 + G +SP +AW++L+GL+TLD+R+QR ++A +VA FLE V RV +PGL SH H Sbjct: 241 DIGAVMSPHDAWLILRGLKTLDVRLQRHCDSAQRVAEFLEQHPAVTRVYYPGLKSHSGHR 300 Query: 305 LAMSQMAAAGPIFSIELDGGRTQAHGLLDALGLIDISNNIGDSRSLMTHPASTTHSGVAE 364 QMA AG + + EL QA + L L I+ ++GD+ SL+ HPAS THS Sbjct: 301 FIGGQMAKAGGVIAFELAASLEQAMAFVGYLKLFSIAVSLGDAESLIQHPASMTHSPYTP 360 Query: 365 DQRLLMGVGEGMLRLNVGLEDPEDLIADLDQAL 397 + R G+ + +LR+++GLED D+I DL+QAL Sbjct: 361 EARQAAGISDNLLRISIGLEDCGDIIEDLNQAL 393 Lambda K H 0.319 0.134 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 353 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 397 Length adjustment: 31 Effective length of query: 371 Effective length of database: 366 Effective search space: 135786 Effective search space used: 135786 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory