GapMind for Amino acid biosynthesis

 

Aligments for a candidate for metZ in Shewanella sp. ANA-3

Align O-succinylhomoserine sulfhydrylase; OSH sulfhydrylase; OSHS sulfhydrylase; EC 2.5.1.- (characterized)
to candidate 7026472 Shewana3_3614 cystathionine gamma-synthase (RefSeq)

Query= SwissProt::P55218
         (403 letters)



>lcl|FitnessBrowser__ANA3:7026472 Shewana3_3614 cystathionine
           gamma-synthase (RefSeq)
          Length = 393

 Score =  258 bits (659), Expect = 2e-73
 Identities = 154/399 (38%), Positives = 231/399 (57%), Gaps = 14/399 (3%)

Query: 7   AGRLDSDLEGAAFDTLAVRAG-QRRTPEGEHGEALFTTSSYVFRTAADAAARFAGEVPGN 65
           AG+L ++ + A   TLAVR G +  T  G     ++ +++Y F    +            
Sbjct: 3   AGKLVTERQLA---TLAVRQGIESDTQYGAVVPPIYLSTNYAFDGHKNPREFD------- 52

Query: 66  VYSRYTNPTVRTFEERIAALEGAEQAVATASGMSAILALVMSLCSSGDHVLVSRSVFGST 125
            YSR  NPT     + +A LE     V T +GM+AI  LV +L    D ++V    +G +
Sbjct: 53  -YSRSGNPTRSILGDALAKLEKGATGVVTCTGMAAI-TLVTTLLGPDDLLVVPHDCYGGS 110

Query: 126 ISLFDKYFKRFGIQVDYPPLSDLAAWEAACKPNTKLFFVESPSNPLAELVDIAALAEIAH 185
             LF    K+   ++     +D  A E A     K+ ++E+PSNPL  +VDI A+A+ +H
Sbjct: 111 YRLFTNLAKKGQFKLLVVDQTDAQALEQAIAQQPKMVWIETPSNPLLRVVDIEAIAKASH 170

Query: 186 AKGALLAVDNCFCTPALQQPLKLGADVVIHSATKYIDGQGRGMGGVVAGRGEQMKEVVGF 245
           A GAL+ VDN F +P LQQPL LGAD+VIHS TKYI+G    +GG V  +  Q+ E + +
Sbjct: 171 AVGALVVVDNTFLSPILQQPLLLGADIVIHSTTKYINGHSDVVGGAVIAKDPQLGETLHW 230

Query: 246 L-RTAGPTLSPFNAWLFLKGLETLRIRMQAHSASALALAEWLERQPGIERVYYAGLPSHP 304
              T G T S F+++  L+GL TL +R++ H ++A  + + L   P + +VYY GL  HP
Sbjct: 231 WSNTLGLTGSAFDSYQTLRGLRTLAVRIREHQSNAQRIVDVLTSSPVVSKVYYPGLADHP 290

Query: 305 QHELARRQQSGFGAVVSFDVKGGRDAAWRFIDATRMVSITTNLGDTKTTIAHPATTSHGR 364
            H +A +QQ GFGA++SF++KGG      F+DA  + S+  +LG  ++ +A PAT +H  
Sbjct: 291 GHAIAAKQQKGFGAMLSFELKGGEAEVVAFLDALSLFSVAESLGGVESLVAVPATMTHRA 350

Query: 365 LSPEDRARAGIGDSLIRVAVGLEDLDDLKADMARGLAAL 403
           + P+ R  AGI D+L+R++VG+ED DDL AD+  GLAA+
Sbjct: 351 MEPQARFEAGIKDTLLRLSVGIEDADDLVADIQAGLAAV 389


Lambda     K      H
   0.319    0.133    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 349
Number of extensions: 17
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 403
Length of database: 393
Length adjustment: 31
Effective length of query: 372
Effective length of database: 362
Effective search space:   134664
Effective search space used:   134664
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory