GapMind for Amino acid biosynthesis

 

Aligments for a candidate for cmutase in Shewanella sp. ANA-3

Align P-protein; EC 4.2.1.51; EC 5.4.99.5 (characterized)
to candidate 7025858 Shewana3_3007 chorismate mutase / prephenate dehydratase (RefSeq)

Query= CharProtDB::CH_024084
         (386 letters)



>lcl|FitnessBrowser__ANA3:7025858 Shewana3_3007 chorismate mutase /
           prephenate dehydratase (RefSeq)
          Length = 667

 Score =  411 bits (1057), Expect = e-119
 Identities = 213/386 (55%), Positives = 278/386 (72%), Gaps = 7/386 (1%)

Query: 1   MTSENPLLALREKISALDEKLLALLAERRELAVEVGKAKLLSHRPVRDIDRERDLLERLI 60
           M    PL   RE+I+ LD +LL+LLAERR L++EV ++K +  RP+RD  RE++LL RL+
Sbjct: 1   MQKPQPLNQTREQITHLDNELLSLLAERRRLSLEVARSKEVDVRPIRDTQREKELLARLV 60

Query: 61  TLGKAHHLDAHYITRLFQLIIEDSVLTQQALLQQHLNKINPHSAR----IAFLGPKGSYS 116
           T G+   LDAHY+  L+Q IIEDSVL QQA L     + NP + +    IA+LG +GSYS
Sbjct: 61  TAGREKGLDAHYVISLYQSIIEDSVLNQQAYLH---GRANPETQKQQYCIAYLGARGSYS 117

Query: 117 HLAARQYAARHFEQFIESGCAKFADIFNQVETGQADYAVVPIENTSSGAINDVYDLLQHT 176
           +LAA +Y  R   + ++ GC  F +I   VE+G ADY  +PIENTSSG+IN+VYD+LQHT
Sbjct: 118 YLAASRYCQRRQVEMLDLGCQSFDEIVQAVESGHADYGFLPIENTSSGSINEVYDVLQHT 177

Query: 177 SLSIVGEMTLTIDHCLLVSGTTDLSTINTVYSHPQPFQQCSKFLNRYPHWKIEYTESTSA 236
           SLSIVGE T+ + HCLL    + LS I TVY+HPQP  QCS++L+++   ++EY  S++ 
Sbjct: 178 SLSIVGETTIEVSHCLLGKPGSKLSDIKTVYAHPQPISQCSRYLSQHKDLRLEYCSSSAE 237

Query: 237 AMEKVAQAKSPHVAALGSEAGGTLYGLQVLERIEANQRQNFTRFVVLARKAINVSDQVPA 296
           AMEKV Q+     AA+GS  GG LY L+ +E   ANQ+ N +RF+V+ARKA+ V +Q+PA
Sbjct: 238 AMEKVNQSADNSAAAIGSTEGGALYQLESIESGLANQKINQSRFIVVARKAVAVPEQLPA 297

Query: 297 KTTLLMATGQQAGALVEALLVLRNHNLIMTRLESRPIHGNPWEEMFYLDIQANLESAEMQ 356
           KTTL+MATGQ+AGALVEALLVL+ H L M++LESRPI G PWEEMFYLDI AN+ S  MQ
Sbjct: 298 KTTLIMATGQKAGALVEALLVLKAHQLNMSKLESRPIPGTPWEEMFYLDIDANISSEAMQ 357

Query: 357 KALKELGEITRSMKVLGCYPSENVVP 382
           + LK+L  ITR +KVLGCYP E V P
Sbjct: 358 QGLKQLERITRFIKVLGCYPCETVKP 383


Lambda     K      H
   0.318    0.132    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 529
Number of extensions: 16
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 386
Length of database: 667
Length adjustment: 34
Effective length of query: 352
Effective length of database: 633
Effective search space:   222816
Effective search space used:   222816
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

Align candidate 7025858 Shewana3_3007 (chorismate mutase / prephenate dehydratase (RefSeq))
to HMM TIGR01797 (chorismate mutase (EC 5.4.99.5))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01797.hmm
# target sequence database:        /tmp/gapView.23411.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01797  [M=83]
Accession:   TIGR01797
Description: CM_P_1: chorismate mutase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
    4.9e-32   96.2   2.8    1.1e-31   95.1   2.8    1.7  1  lcl|FitnessBrowser__ANA3:7025858  Shewana3_3007 chorismate mutase 


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__ANA3:7025858  Shewana3_3007 chorismate mutase / prephenate dehydratase (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   95.1   2.8   1.1e-31   1.1e-31       2      83 .]       8      89 ..       7      89 .. 0.98

  Alignments for each domain:
  == domain 1  score: 95.1 bits;  conditional E-value: 1.1e-31
                         TIGR01797  2 lalrekisaidkkllkllaerkelafevakskllsqkavrdierekkllqklitlgkkyqleaeyitrlfqliiedsvl 80
                                       + re+i+++d++ll llaer++l +eva+sk+++ +++rd +rek+ll +l+t g++  l+a+y+ +l+q iiedsvl
  lcl|FitnessBrowser__ANA3:7025858  8 NQTREQITHLDNELLSLLAERRRLSLEVARSKEVDVRPIRDTQREKELLARLVTAGREKGLDAHYVISLYQSIIEDSVL 86
                                      678**************************************************************************** PP

                         TIGR01797 81 tqq 83
                                       qq
  lcl|FitnessBrowser__ANA3:7025858 87 NQQ 89
                                      *98 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (83 nodes)
Target sequences:                          1  (667 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 14.84
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory