Align 4-aminobutyrate aminotransferase GabT; 5-aminovalerate transaminase; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; L-AIBAT; EC 2.6.1.19; EC 2.6.1.48 (characterized)
to candidate BPHYT_RS10155 BPHYT_RS10155 2,2-dialkylglycine decarboxylase
Query= SwissProt::P22256 (426 letters) >FitnessBrowser__BFirm:BPHYT_RS10155 Length = 433 Score = 208 bits (530), Expect = 2e-58 Identities = 134/438 (30%), Positives = 224/438 (51%), Gaps = 24/438 (5%) Query: 2 NSNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPK 61 N++ + Q + R G P+ +RA+ V+D +GR LDF G GH HP+ Sbjct: 4 NNDAVFWRNAKQHLIRYGGTFEPMIIERAQGSFVYDADGRAILDFTSGQMSAVLGHSHPE 63 Query: 62 VVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVKI 121 +V+ + KL H F + P ++L + + P D + LL++TG+E+ E A+++ Sbjct: 64 IVSVINEYAGKLDHL-FSGMLSRPVVDLATRLAEITP-DGLDRALLLSTGAESNEAAIRM 121 Query: 122 ARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGM-GLMPGHVYRALYPCPL----- 175 A+ T + + F+ ++HG T + T YSAG G+ P V P P Sbjct: 122 AKLVTGKYEIVGFAQSWHGMTAAAASAT-----YSAGRKGVGPAAVGSFAIPAPFLYRPR 176 Query: 176 ---HGISEDDAIASIHRIFK--NDAAPEDIAAIVIEPVQGEGGFYASSPAFMQRLRALCD 230 HG + D +A + F + + ++AA + EP+ GG +M L+ C+ Sbjct: 177 FERHG--DYDYLAELDYAFDLIDRQSSGNLAAFIAEPILSSGGIIELPEGYMTALKRKCE 234 Query: 231 EHGIMLIADEVQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVA 290 E G++LI DE Q+G GRTGT+FA ++ GV PD+ T +K++ G PLA V A++ + Sbjct: 235 ERGMLLILDEAQTGVGRTGTMFACQRDGVTPDILTLSKTLGAGLPLAAVVTSAQIEERAH 294 Query: 291 PGG--LGGTYAGNPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDV 348 G T+ +P+ L VL+V E++ L+ +AN +G +LK GLL + E+ IGD+ Sbjct: 295 ELGYLFYTTHVSDPLPAAVGLRVLEVVERDGLVARANLMGARLKRGLLDLMERFDCIGDI 354 Query: 349 RGLGAMIAIELFEDGDHNKPDAKLTAEIVARARDKGLI--LLSCGPYYNVLRILVPLTIE 406 RG G ++ +E+ +D +P L A+I + GL ++ V RI PLT+ Sbjct: 355 RGRGLLLGMEIVKDRRTKEPADGLGAKITRECMNLGLSMNIVQLPGMGGVFRIAPPLTVH 414 Query: 407 DAQIRQGLEIISQCFDEA 424 + +I GL+++ Q + + Sbjct: 415 EDEIDLGLDLLGQAIERS 432 Lambda K H 0.320 0.137 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 471 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 433 Length adjustment: 32 Effective length of query: 394 Effective length of database: 401 Effective search space: 157994 Effective search space used: 157994 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory