Align Argininosuccinate synthase; Citrulline--aspartate ligase; EC 6.3.4.5 (characterized)
to candidate BPHYT_RS15920 BPHYT_RS15920 argininosuccinate synthase
Query= SwissProt::P59846 (400 letters) >FitnessBrowser__BFirm:BPHYT_RS15920 Length = 408 Score = 489 bits (1258), Expect = e-143 Identities = 239/401 (59%), Positives = 304/401 (75%), Gaps = 6/401 (1%) Query: 2 KIVLAYSGGLDTSIILKWLKETYRAEVIAFTADIGQGEEVEEAREKALRTGASK--AIAL 59 K+VLAYSGGLDTS+ILKWL++ Y AEV+ FTADIGQGEE+E AR+KAL+ G + Sbjct: 6 KVVLAYSGGLDTSVILKWLQDNYDAEVVTFTADIGQGEELEPARKKALQLGIKQDNIFIE 65 Query: 60 DLKEEFVRDFVFPMMRAGAVYEGYYLLGTSIARPLIAKHLVRIAEEEGAEAIAHGATGKG 119 DL+EEFVRDFVFPM RA +YEG YLLGTSIARPLIAK + IA GA+A++HGATGKG Sbjct: 66 DLREEFVRDFVFPMFRANTIYEGEYLLGTSIARPLIAKRQIEIARATGAQAVSHGATGKG 125 Query: 120 NDQVRFELTAYALKPDIKVIAPWREWSFQGRKEMIAYAEAHGIPVPVTQEK---PYSMDA 176 NDQVRFEL YAL+P IKVIAPWREW R++++AYAE GIP+ + ++ PYSMDA Sbjct: 126 NDQVRFELGYYALEPGIKVIAPWREWDLLSREKLLAYAEKAGIPIEMKHKQGGAPYSMDA 185 Query: 177 NLLHISYEGGVLEDPWAEPPKGMFRMTQDPEEAPDAPEYVEVEFFEGDPVAVNGERLSPA 236 NLLHIS+EG LEDP AE M+R T PE+APD EY+++E+ GDPVA+NG+RLS A Sbjct: 186 NLLHISFEGRHLEDPKAEAEADMWRWTVSPEQAPDQAEYIDIEYEHGDPVAINGKRLSAA 245 Query: 237 ALLQRLNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGGTILYHARRAVESLTLDREVLH 296 +L LN +GG+HG+GR+D+VENR+VGMKSRG YETPGGTI+ A R +ES+TLDREV H Sbjct: 246 EMLTELNRLGGKHGIGRLDLVENRYVGMKSRGCYETPGGTIMLKAHRGIESITLDREVAH 305 Query: 297 QRDMLSPKYAELVYYGFWYAPEREALQAYFDHVARSVTGVARLKLYKGNVYVVGRKAPKS 356 +D L +YA L+Y G+W++PER A+Q DH V G R+KLYKG+V VV R + ++ Sbjct: 306 LKDDLMARYASLIYNGYWWSPERRAIQVLIDHTQEKVNGWVRVKLYKGSVSVVARDSKET 365 Query: 357 LYRQDLVSFDEAGG-YDQKDAEGFIKIQALRLRVRALVERE 396 L+ + + +FD+ GG Y+Q DA GFIK+ ALR+R+ R+ Sbjct: 366 LFDKTIATFDDDGGAYNQADAGGFIKLNALRMRIAENARRQ 406 Lambda K H 0.319 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 538 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 408 Length adjustment: 31 Effective length of query: 369 Effective length of database: 377 Effective search space: 139113 Effective search space used: 139113 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate BPHYT_RS15920 BPHYT_RS15920 (argininosuccinate synthase)
to HMM TIGR00032 (argG: argininosuccinate synthase (EC 6.3.4.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00032.hmm # target sequence database: /tmp/gapView.15908.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00032 [M=394] Accession: TIGR00032 Description: argG: argininosuccinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-147 477.1 0.0 3.1e-147 476.9 0.0 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS15920 BPHYT_RS15920 argininosuccinate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS15920 BPHYT_RS15920 argininosuccinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 476.9 0.0 3.1e-147 3.1e-147 1 390 [. 6 401 .. 6 405 .. 0.96 Alignments for each domain: == domain 1 score: 476.9 bits; conditional E-value: 3.1e-147 TIGR00032 1 kvvlaysGGlDtsvalklleek.gaeviavtvdvGqpeedldaieekalklGaek..ayviDareefvkd 67 kvvlaysGGlDtsv+lk+l+++ aev+++t+d+Gq+ e+l+ +++kal+lG ++ + D reefv+d lcl|FitnessBrowser__BFirm:BPHYT_RS15920 6 KVVLAYSGGLDTSVILKWLQDNyDAEVVTFTADIGQG-EELEPARKKALQLGIKQdnIFIEDLREEFVRD 74 8*********************99************9.9*************875114556********* PP TIGR00032 68 ylfaaiqanavyegkYllstaLaRpliakklvevakkegaeavahGctgKGnDqvRFelsilllnpdlkv 137 ++f+ +an++yeg+Yll+t++aRpliak+++e+a+ ga+av+hG+tgKGnDqvRFel ++l+p +kv lcl|FitnessBrowser__BFirm:BPHYT_RS15920 75 FVFPMFRANTIYEGEYLLGTSIARPLIAKRQIEIARATGAQAVSHGATGKGNDQVRFELGYYALEPGIKV 144 ********************************************************************** PP TIGR00032 138 iaPvreleli.ReeeieyaaekGievpvekek...aysiDenllgrsiEageLEdpsteppediyelvkd 203 iaP+re++l Re++++ya++ Gi++++++++ +ys+D nll++s E+ +LEdp++e d+++++++ lcl|FitnessBrowser__BFirm:BPHYT_RS15920 145 IAPWREWDLLsREKLLAYAEKAGIPIEMKHKQggaPYSMDANLLHISFEGRHLEDPKAEAEADMWRWTVS 214 ********987****************998644449*********************************9 PP TIGR00032 204 piektedepevveieFekGvPvalngeslepvelilkaneiagkhGvGriDivEdRiiglKsReiYEapa 273 p++++ d++e+++ie+e+G Pva+ng++l++ e++ ++n+++gkhG+Gr+D vE+R++g+KsR++YE+p+ lcl|FitnessBrowser__BFirm:BPHYT_RS15920 215 PEQAP-DQAEYIDIEYEHGDPVAINGKRLSAAEMLTELNRLGGKHGIGRLDLVENRYVGMKSRGCYETPG 283 98888.**************************************************************** PP TIGR00032 274 lllLikAhkdLetlvltkdvlefkeiveekyseliYkGlwfdplaealdalikktqervtGtvrvklfkG 343 ++++kAh+ +e+ +l+++v+++k+ +y+ liY+G+w++p++ a++ li++tqe+v+G+vrvkl+kG lcl|FitnessBrowser__BFirm:BPHYT_RS15920 284 GTIMLKAHRGIESITLDREVAHLKDDLMARYASLIYNGYWWSPERRAIQVLIDHTQEKVNGWVRVKLYKG 353 ********************************************************************** PP TIGR00032 344 naivigrkseyslYdeelvsfek.dkefdqkdaiGfikirglqikvyr 390 ++ v++r+s+++l+d+++++f+ +++q da Gfik+++l++++ + lcl|FitnessBrowser__BFirm:BPHYT_RS15920 354 SVSVVARDSKETLFDKTIATFDDdGGAYNQADAGGFIKLNALRMRIAE 401 **********************8446799*************998766 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (394 nodes) Target sequences: 1 (408 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.17 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory