Align Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 (uncharacterized)
to candidate BPHYT_RS04235 BPHYT_RS04235 aspartate carbamoyltransferase
Query= curated2:O27495 (301 letters) >FitnessBrowser__BFirm:BPHYT_RS04235 Length = 341 Score = 107 bits (268), Expect = 3e-28 Identities = 97/319 (30%), Positives = 151/319 (47%), Gaps = 34/319 (10%) Query: 1 MKHLLSVCDMDNVV--DLLDLADDYKEGKIRE----KILRGKTLAMIFEKSSTRTRVSFE 54 +KHLLS+ + + +LD AD + RE +LRGK++ +F ++STRTR +FE Sbjct: 36 LKHLLSIEGLPKAIVNHILDTADQFVSVTDREVKKVPLLRGKSVFNLFFENSTRTRTTFE 95 Query: 55 VGAFQMGAQPLYLSASDLQLGRGEPIADTARTLSR-YVDGIMIRAISHSDVVELAGEAS- 112 + A ++ A L L+ + +GE + DT LS + D ++R S +A + Sbjct: 96 IAATRLSADVLNLNINASSTSKGESLLDTINNLSAMHADMFVVRHASSGAPYLIAQHCAP 155 Query: 113 -VPVIN-GLTDLEHPCQALADMQTIREKLGGFDG-RLVFVGD--GNNVCHSLLLITATLG 167 V VIN G HP Q L DM TIR F R+ VGD + V S + TLG Sbjct: 156 HVHVINAGDGRHAHPTQGLLDMYTIRHYKKDFTKLRVAIVGDILHSRVARSDIHALTTLG 215 Query: 168 MDMDVACPPGYEPDPGIREMAGKIADETGSRIRVIHDPSEAVRGADVVYTDVWVSMGYED 227 + A P G+ +M +RV H+ E ++ DV+ + + ++ Sbjct: 216 VPEVRAIGPRTLLPGGLEQMG----------VRVFHNLDEGLKDVDVI-----IMLRLQN 260 Query: 228 EA------EDRLEVFRPYQVNMELMELAAPEAIFMHCLPAVRGQETTAEVIDGPHSVVWD 281 E E F+ + + E + LAAP+AI MH P RG E ++V DGP SV+ + Sbjct: 261 ERMSGALLPSAQEYFKSWGLTPERLALAAPDAIVMHPGPMNRGVEIDSQVADGPQSVILN 320 Query: 282 QAENRLHAQKAIMHWLMGD 300 Q + + A+M + G+ Sbjct: 321 QVTFGIAVRMAVMGIVAGN 339 Lambda K H 0.320 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 211 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 341 Length adjustment: 28 Effective length of query: 273 Effective length of database: 313 Effective search space: 85449 Effective search space used: 85449 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory