Align Ornithine carbamoyltransferase (EC 2.1.3.3) (characterized)
to candidate BPHYT_RS15915 BPHYT_RS15915 ornithine carbamoyltransferase
Query= reanno::HerbieS:HSERO_RS07185 (304 letters) >FitnessBrowser__BFirm:BPHYT_RS15915 Length = 309 Score = 453 bits (1166), Expect = e-132 Identities = 213/303 (70%), Positives = 259/303 (85%), Gaps = 1/303 (0%) Query: 3 IKHYLQFSDFTLDEYEYVIERSRVIKRKFKNYEPHHTLADRTLVMVFEKNSTRTRLSFEA 62 I+HYLQF DF+L++YEYV+ER+R++KRKFKNYE +H L DRTL M+FEKNSTRTRLSFEA Sbjct: 6 IRHYLQFKDFSLEDYEYVLERARILKRKFKNYETYHPLHDRTLAMIFEKNSTRTRLSFEA 65 Query: 63 GMHQMGGAAIYLNTRDSQLGRGEPVEDAAQVMSRMCDVIMIRTYGQEIIERFAKHSRVPV 122 G+ Q+GG A++++TRD+QLGRGEP+EDAAQV+SRM D+IMIRT+GQ+I++RF+++SRVPV Sbjct: 66 GIFQLGGHAVFMSTRDTQLGRGEPIEDAAQVISRMVDIIMIRTFGQDILQRFSENSRVPV 125 Query: 123 INGLTNEQHPCQVLADVFTYIEHHGSIQGKIVAWVGDANNMLYSWLQAAEVFGFHVNVST 182 INGLTNE HPCQVLAD+FTY EH G I+ K VAWVGDANNMLY+W++AA++ GF + +ST Sbjct: 126 INGLTNEYHPCQVLADIFTYFEHRGPIRDKTVAWVGDANNMLYTWIEAAQILGFKLRLST 185 Query: 183 PKGYDIDPAQVSPGNKN-YTFFADPADACQDADLVTTDVWTSMGFEAENNARLKAFDGWI 241 P GY +D A V+ + Y F DP +AC ADLVTTDVWTSMGFEAEN AR KAF W Sbjct: 186 PPGYKLDRAMVAAESAPFYEEFDDPNEACTGADLVTTDVWTSMGFEAENEARKKAFADWC 245 Query: 242 VDQAKMARAKKDALFMHCLPAHRGEEVAAEVIDGPQSVVWEEAENRLHVQKALLEYLVHG 301 VD MARA DALFMHCLPAHRGEEV+AEVIDGPQSVVW+EAENRLHVQKAL+EYL+ G Sbjct: 246 VDADMMARANPDALFMHCLPAHRGEEVSAEVIDGPQSVVWDEAENRLHVQKALMEYLLLG 305 Query: 302 RFD 304 + + Sbjct: 306 KLN 308 Lambda K H 0.321 0.135 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 375 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 304 Length of database: 309 Length adjustment: 27 Effective length of query: 277 Effective length of database: 282 Effective search space: 78114 Effective search space used: 78114 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate BPHYT_RS15915 BPHYT_RS15915 (ornithine carbamoyltransferase)
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00658.hmm # target sequence database: /tmp/gapView.7358.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00658 [M=304] Accession: TIGR00658 Description: orni_carb_tr: ornithine carbamoyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-111 357.8 0.0 2.8e-111 357.5 0.0 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS15915 BPHYT_RS15915 ornithine carbamoy Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS15915 BPHYT_RS15915 ornithine carbamoyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 357.5 0.0 2.8e-111 2.8e-111 1 303 [. 7 303 .. 7 304 .. 0.98 Alignments for each domain: == domain 1 score: 357.5 bits; conditional E-value: 2.8e-111 TIGR00658 1 rhllslldlseeelkellelakklkkekkkgkeekklkgktlaliFekrstRtRvsfevaayelGaqvly 70 rh+l+++d+s e+ +++le+a+ lk++ k+ ++ + l+ +tla+iFek+stRtR+sfe+++++lG+++++ lcl|FitnessBrowser__BFirm:BPHYT_RS15915 7 RHYLQFKDFSLEDYEYVLERARILKRKFKNYETYHPLHDRTLAMIFEKNSTRTRLSFEAGIFQLGGHAVF 76 89*****************************9************************************** PP TIGR00658 71 lnkeelqlgrkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdlehPcqilaDlltik 140 +++ ++qlgr+e+i+D a+v+sr+vd+i++R++ +++++ +++++ vPvingLt++ hPcq+laD++t lcl|FitnessBrowser__BFirm:BPHYT_RS15915 77 MSTRDTQLGRGEPIEDAAQVISRMVDIIMIRTFGQDILQRFSENSRVPVINGLTNEYHPCQVLADIFTYF 146 ********************************************************************** PP TIGR00658 141 eklgklkevklvyvGDannvanslllaaaklGldvvvatPeglepeaeivkkakkiakenggkleltedp 210 e+ g + + ++++vGDann+ + + aa lG++++++tP+g++ + ++v +e+ e +dp lcl|FitnessBrowser__BFirm:BPHYT_RS15915 147 EHRGPIRDKTVAWVGDANNMLYTWIEAAQILGFKLRLSTPPGYKLDRAMVA------AESAPFYEEFDDP 210 ********************************************9988764......45666778899** PP TIGR00658 211 kkavkdadviytDvwvsmGeeekkeerlkllkpyqvneellelakpevkflhCLPavrGeevtdevlege 280 ++a ++ad++ tDvw+smG e+++e+r k++ ++ v+ ++++ a+p++ f+hCLPa+rGeev+ ev++g+ lcl|FitnessBrowser__BFirm:BPHYT_RS15915 211 NEACTGADLVTTDVWTSMGFEAENEARKKAFADWCVDADMMARANPDALFMHCLPAHRGEEVSAEVIDGP 280 ********************************************************************** PP TIGR00658 281 asivfdeaenRlhaqkavlkall 303 +s+v+deaenRlh+qka++++ll lcl|FitnessBrowser__BFirm:BPHYT_RS15915 281 QSVVWDEAENRLHVQKALMEYLL 303 *******************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (309 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.35 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory