Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate BPHYT_RS23245 BPHYT_RS23245 phospho-2-dehydro-3-deoxyheptonate aldolase
Query= BRENDA::Q9K169 (351 letters) >lcl|FitnessBrowser__BFirm:BPHYT_RS23245 BPHYT_RS23245 phospho-2-dehydro-3-deoxyheptonate aldolase Length = 372 Score = 404 bits (1038), Expect = e-117 Identities = 205/346 (59%), Positives = 255/346 (73%), Gaps = 5/346 (1%) Query: 8 DDIKIKEVKELLPPIAHLYELPISKEASGLVHRTRQEISDLVHGRDKRLLVIIGPCSIHD 67 DD++I V+ L+ P ELP+ LV +TR EI+D++HGRD RL++I+GPCSIHD Sbjct: 26 DDVRIGAVRPLISPALLQDELPVPPSVQTLVEKTRAEIADILHGRDDRLVMIVGPCSIHD 85 Query: 68 PKAALEYAERLLKLRKQYENELLIVMRVYFEKPRTTVGWKGLINDPHLDGTFDINFGLRQ 127 A+EYA +L Y+++LLIVMRVYFEKPRTTVGWKG INDP LDG+F IN GLR Sbjct: 86 HDQAIEYAHKLKVAADTYKDDLLIVMRVYFEKPRTTVGWKGYINDPRLDGSFRINEGLRL 145 Query: 128 ARSLLLSLNNMGMPASTEFLDMITPQYYADLISWGAIGARTTESQVHRELASGLSCPVGF 187 AR LLL +N +G+ +TEFLD+++PQY ADLI+WGAIGARTTESQ HR+LASGLSCP+GF Sbjct: 146 ARQLLLDINGLGLATATEFLDLLSPQYIADLIAWGAIGARTTESQSHRQLASGLSCPIGF 205 Query: 188 KNGTDGNLKIAIDAIGAASHSHHFLSVTKAGHSAIVHTGGNPDCHVILRGGKE-PNYDAE 246 KNGTDG ++IA DAI AA SH F+ +TK G +AI T GN D HVILRGGK+ PNYD+ Sbjct: 206 KNGTDGGVQIAADAIVAARASHAFMGMTKMGMAAIFETRGNDDAHVILRGGKKGPNYDSA 265 Query: 247 HVSEAAEQLRAAGVTDKLMIDCSHANSRKDYTRQMEVAQDIAAQLEQDGGNIMGVMVESH 306 V E L++AG+ +++M+DCSHANS K + RQ+EV QD+ QL Q I+GVM+ESH Sbjct: 266 SVEATCEALKSAGLREQVMVDCSHANSGKSHLRQLEVVQDLTQQLSQRERRIIGVMLESH 325 Query: 307 LVEGRQD-KPEV---YGKSITDACIGWGATEELLALLAGANKKRMA 348 L EGRQD KP V +G SITDAC+ W TE L LA A +KR A Sbjct: 326 LEEGRQDLKPGVPLRHGVSITDACVSWTQTEPALETLAEATRKRRA 371 Lambda K H 0.318 0.135 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 380 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 351 Length of database: 372 Length adjustment: 29 Effective length of query: 322 Effective length of database: 343 Effective search space: 110446 Effective search space used: 110446 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate BPHYT_RS23245 BPHYT_RS23245 (phospho-2-dehydro-3-deoxyheptonate aldolase)
to HMM TIGR00034 (3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00034.hmm # target sequence database: /tmp/gapView.6762.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00034 [M=342] Accession: TIGR00034 Description: aroFGH: 3-deoxy-7-phosphoheptulonate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-156 506.2 0.0 2e-156 506.0 0.0 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS23245 BPHYT_RS23245 phospho-2-dehydro- Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS23245 BPHYT_RS23245 phospho-2-dehydro-3-deoxyheptonate aldolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 506.0 0.0 2e-156 2e-156 1 342 [] 26 370 .. 26 370 .. 0.99 Alignments for each domain: == domain 1 score: 506.0 bits; conditional E-value: 2e-156 TIGR00034 1 ddlrivkidelltPeelkakfpltekaaekvaksrkeiadilaGkddrllvviGPcsihdpeaaleyakr 70 dd+ri ++ +l++P+ l+ + p+ +++++ v+k+r eiadil+G+ddrl++++GPcsihd a+eya++ lcl|FitnessBrowser__BFirm:BPHYT_RS23245 26 DDVRIGAVRPLISPALLQDELPVPPSVQTLVEKTRAEIADILHGRDDRLVMIVGPCSIHDHDQAIEYAHK 95 799******************************************************************* PP TIGR00034 71 lkklaeklkddleivmrvyfekPrttvGWkGlindPdlnesfdvnkGlriarkllldlvelglplatell 140 lk a+ +kddl ivmrvyfekPrttvGWkG indP l++sf++n+Glr+ar+llld++ lgl +ate+l lcl|FitnessBrowser__BFirm:BPHYT_RS23245 96 LKVAADTYKDDLLIVMRVYFEKPRTTVGWKGYINDPRLDGSFRINEGLRLARQLLLDINGLGLATATEFL 165 ********************************************************************** PP TIGR00034 141 dtispqyladllswgaiGarttesqvhrelasglslpvgfkngtdGslkvaidairaaaaehlflsvtka 210 d spqy+adl++wgaiGarttesq hr+lasgls+p+gfkngtdG++++a dai aa+a+h f+++tk lcl|FitnessBrowser__BFirm:BPHYT_RS23245 166 DLLSPQYIADLIAWGAIGARTTESQSHRQLASGLSCPIGFKNGTDGGVQIAADAIVAARASHAFMGMTKM 235 ********************************************************************** PP TIGR00034 211 GqvaivetkGnedghiilrGGkk.pnydaedvaevkeelekaglkeelmidfshgnsnkdykrqlevaes 279 G +ai et+Gn+d+h+ilrGGkk pnyd+++v++++e l+ agl+e++m+d+sh+ns k + rqlev+++ lcl|FitnessBrowser__BFirm:BPHYT_RS23245 236 GMAAIFETRGNDDAHVILRGGKKgPNYDSASVEATCEALKSAGLREQVMVDCSHANSGKSHLRQLEVVQD 305 ********************************************************************** PP TIGR00034 280 vveqiaeGekaiiGvmiesnleeGnqsl..keelkyGksvtdacigwedteallrklaeavkerr 342 +++q+++ e+ iiGvm+es+leeG+q+l + +l +G+s+tdac++w +te l+ laea ++rr lcl|FitnessBrowser__BFirm:BPHYT_RS23245 306 LTQQLSQRERRIIGVMLESHLEEGRQDLkpGVPLRHGVSITDACVSWTQTEPALETLAEATRKRR 370 ****************************656789**************************99986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (342 nodes) Target sequences: 1 (372 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.88 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory