Align Cystathionine gamma-lyase; CGL; CSE; Cysteine desulfhydrase; Cysteine-protein sulfhydrase; Gamma-cystathionase; Homocysteine desulfhydrase; Probasin-related antigen; PRB-RA; EC 4.4.1.1; EC 4.4.1.2 (characterized)
to candidate BPHYT_RS09190 BPHYT_RS09190 cystathionine beta-lyase
Query= SwissProt::P18757 (398 letters) >FitnessBrowser__BFirm:BPHYT_RS09190 Length = 394 Score = 180 bits (457), Expect = 6e-50 Identities = 108/341 (31%), Positives = 180/341 (52%), Gaps = 15/341 (4%) Query: 59 YSRSGNPTRNCLEKAVAALDGAKHCLTFARGLAATTTITH-LLKAGDEVICMDEVYGGTN 117 Y PT L + +A ++G H L GL++ + + L+KAGD+V+ D VY Sbjct: 59 YGLHATPTSLALAQRLATIEGGNHALLQPSGLSSISNVYFGLVKAGDDVLIPDNVYSPNR 118 Query: 118 RYFRRVASEFGLKISFVDCSKTKLLEAAITPQTKLVWIETPTNPTLKLADIKACAQIVHK 177 + +A +FG+ + + D + I P T+L+W+E P + T+++AD+ A + Sbjct: 119 DHGDWLARDFGITVRYYDPMIGAGMADLIQPNTRLIWLEAPGSVTMEVADVPAITAAA-R 177 Query: 178 HKDIILVVDNTFMSAYFQRPLALGADICMCSATKYMNGHSDVVMGLVSVTSDDLNERLRF 237 ++++ +DNT+ + RP G DI + + TKY +G DV+MG +L+ +L+ Sbjct: 178 ARNVVTAIDNTWSAGLGFRPFDHGVDISVQALTKYQSGGGDVLMGATITVDRELHLKLKA 237 Query: 238 LQNSLGAVPSPFDCYLCCRGLKTLQIRMEKHFRNGMAVARFLESNPRVEKVIYPGLPSHP 297 + +G S DC L R L T+Q+R E+H R+ + +A++L++ P + V++P L P Sbjct: 238 ARMRMGIGVSSDDCSLILRSLPTMQLRFEQHDRSALGLAKWLKTRPEIAAVLHPALSDCP 297 Query: 298 QHELAKRQCTGCPGMVSFYIKGTLQHAQV--FLKNIKLFALAESLGGYESLA---ELPAI 352 HE KR TG G+ S G AQ+ F ++++LF+L S GG SLA ++ ++ Sbjct: 298 GHEFYKRDFTGAGGLFSVVFDGRYSPAQIDTFCESLELFSLGWSWGGAHSLAMPYDVASM 357 Query: 353 MTHASVPEKDRATLGISDTLIRLSVGLEDEKDLLEDLGQAL 393 T P S TL+R +GLE E DL D+ Q+L Sbjct: 358 RTAGQWPH--------SGTLVRFYIGLEAEADLRADMEQSL 390 Lambda K H 0.321 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 334 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 398 Length of database: 394 Length adjustment: 31 Effective length of query: 367 Effective length of database: 363 Effective search space: 133221 Effective search space used: 133221 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory