Align Serine acetyltransferase; SAT; EC 2.3.1.30 (uncharacterized)
to candidate BPHYT_RS29810 BPHYT_RS29810 hexapeptide transferase
Query= curated2:P71405 (171 letters) >FitnessBrowser__BFirm:BPHYT_RS29810 Length = 139 Score = 97.1 bits (240), Expect = 1e-25 Identities = 50/136 (36%), Positives = 78/136 (57%), Gaps = 4/136 (2%) Query: 37 YRLAHALHKRRFYFIARALSQLARFITGIEIHPGAKIGRGLFIDH-GMGVVIGETTEIGD 95 YR+AH LH+ R F+ AL R + + + P +GR + + G+G+V+ +G+ Sbjct: 5 YRIAHLLHRLRVPFLPWALKVFNRIVFSVSLPPSVTVGRNVVFGYQGLGIVVHRQAVLGN 64 Query: 96 DVTIYHGVTLGGTGKFKGKRHPTLGNRVVVGAGAKVLGAICVGDDVKIGANAVVLSDLPT 155 D+ I V +GG G+ P +G+ V++GAGA +LG + +G +VKIGANAVV D+P Sbjct: 65 DIVISPNVVIGGRGQ---PGAPVIGDNVLIGAGACILGPVTIGQNVKIGANAVVTFDVPP 121 Query: 156 GSTAVGSKAKTITKDR 171 T VG A+ + R Sbjct: 122 DVTVVGVPARIVQPRR 137 Lambda K H 0.323 0.142 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 87 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 171 Length of database: 139 Length adjustment: 17 Effective length of query: 154 Effective length of database: 122 Effective search space: 18788 Effective search space used: 18788 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory