Align Histidinol-phosphate aminotransferase 1; EC 2.6.1.9; Imidazole acetol-phosphate transaminase 1 (uncharacterized)
to candidate BPHYT_RS14905 BPHYT_RS14905 histidinol-phosphate aminotransferase
Query= curated2:Q46Y48 (376 letters) >lcl|FitnessBrowser__BFirm:BPHYT_RS14905 BPHYT_RS14905 histidinol-phosphate aminotransferase Length = 370 Score = 563 bits (1452), Expect = e-165 Identities = 279/363 (76%), Positives = 317/363 (87%) Query: 13 FGPDYVRAISPYIAGKPISEVAREFGLDEAGIVKLASNENPLGMPESAKHAAAAAIAELG 72 FGP YVRAI+PYIAGKPISEVAREFGLDEA IVKLASNENPLGMPESA+ A A A +ELG Sbjct: 5 FGPSYVRAIAPYIAGKPISEVAREFGLDEATIVKLASNENPLGMPESAQRAMAQAASELG 64 Query: 73 RYPDSNGFELKAALSTKLGVPQDWLTLGNGSNDILELAAHALVTPGQSIVYAEYSFAVYA 132 RYPD+N FELKAALS + GVP DW+TLGNGSNDILE+AAHA V GQSIVYA+YSFAVYA Sbjct: 65 RYPDANAFELKAALSERYGVPADWVTLGNGSNDILEIAAHAFVEKGQSIVYAQYSFAVYA 124 Query: 133 LATQEIGARAIVVKARDYGHDLDAMAAAITSDTRLVFIANPNNPTGTFVPAAALETFLAK 192 LATQ +GARAIVV A YGHDLDAM AA++ DTRL+F+ANPNNPTGTF+ LE FL K Sbjct: 125 LATQGLGARAIVVPAVKYGHDLDAMLAAVSDDTRLIFVANPNNPTGTFIEGPKLEAFLDK 184 Query: 193 VPAEVVVVLDEAYNEYLDDDQQYDSVAWVRRYPNLLVSRTFSKAYGLAGLRIGYAVAQPE 252 VP VVVVLDEAY EYL +++YDS+AWVRRYPNLLVSRTFSKA+GLAGLR+G+A+AQPE Sbjct: 185 VPRHVVVVLDEAYTEYLPQEKRYDSIAWVRRYPNLLVSRTFSKAFGLAGLRVGFAIAQPE 244 Query: 253 LTDLLNRIRQPFNVNSVAQAAAVAALGDTAFLQRSAELNRAGKAQLVEAFSRLGLEFVAS 312 LTDLLNR+RQPFNVN++AQAAA+AAL D AFL++SA LN G +L EAF +LGLE+V S Sbjct: 245 LTDLLNRVRQPFNVNTLAQAAAIAALNDKAFLEKSAALNAQGYRRLTEAFDKLGLEYVPS 304 Query: 313 SGNFVLVRVGDDDDAGARVNVALLRQGVIVRPVGNYGMPRWLRVTIGLPDENAAFIAALE 372 GNFVLVRVG+DD AG RVN+ LL+QGVIVRPVGNYG+P+WLR+TIGLP+EN AFIAALE Sbjct: 305 DGNFVLVRVGNDDAAGNRVNLELLKQGVIVRPVGNYGLPQWLRITIGLPEENEAFIAALE 364 Query: 373 RAL 375 R L Sbjct: 365 RTL 367 Lambda K H 0.318 0.134 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 591 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 370 Length adjustment: 30 Effective length of query: 346 Effective length of database: 340 Effective search space: 117640 Effective search space used: 117640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate BPHYT_RS14905 BPHYT_RS14905 (histidinol-phosphate aminotransferase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.19082.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.6e-113 363.1 0.0 7.4e-113 362.9 0.0 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS14905 BPHYT_RS14905 histidinol-phospha Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS14905 BPHYT_RS14905 histidinol-phosphate aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 362.9 0.0 7.4e-113 7.4e-113 4 348 .. 10 365 .. 7 366 .. 0.97 Alignments for each domain: == domain 1 score: 362.9 bits; conditional E-value: 7.4e-113 TIGR01141 4 ikklepYqpg......arelgek..evvkLnsnEnPfgpsekvkealkeelkklhrYpdpqalelkeala 65 +++++pY +g are+g + +vkL+snEnP+g++e+++ a+ +++++l rYpd++a+elk+al+ lcl|FitnessBrowser__BFirm:BPHYT_RS14905 10 VRAIAPYIAGkpisevAREFGLDeaTIVKLASNENPLGMPESAQRAMAQAASELGRYPDANAFELKAALS 79 8999*****************99999******************************************** PP TIGR01141 66 kylgveeenillgnGsdelielliraflepgdavlvleptysmYevsakiagaevkevplkedgqedlea 135 +++gv ++ ++lgnGs++++e+ ++af+e+g++++++++++++Y++ ++ ga+ + vp+ + g +dl+a lcl|FitnessBrowser__BFirm:BPHYT_RS14905 80 ERYGVPADWVTLGNGSNDILEIAAHAFVEKGQSIVYAQYSFAVYALATQGLGARAIVVPAVKYG-HDLDA 148 ***************************************************************6.9**** PP TIGR01141 136 vleaakekvklvflasPnnPtGnllkreeiekvleev.edalVVvDeAYieFsee...asvlellaeypn 201 +l+a++++++l+f+a+PnnPtG++++ ++e++l++v ++++VV+DeAY+e+ ++ ++ + ++++ypn lcl|FitnessBrowser__BFirm:BPHYT_RS14905 149 MLAAVSDDTRLIFVANPNNPTGTFIEGPKLEAFLDKVpRHVVVVLDEAYTEYLPQekrYDSIAWVRRYPN 218 *************************************88**************9999999********** PP TIGR01141 202 lvvlrTlSKafgLAglRvGyaianaeiiealekvrapynvsslaleaavaalrdsdkiektveevkkere 271 l+v+rT+SKafgLAglRvG+aia++e+ + l++vr+p+nv++la++aa+aal+d++++ek+ + ++++ + lcl|FitnessBrowser__BFirm:BPHYT_RS14905 219 LLVSRTFSKAFGLAGLRVGFAIAQPELTDLLNRVRQPFNVNTLAQAAAIAALNDKAFLEKSAALNAQGYR 288 ********************************************************************** PP TIGR01141 272 rlleelkkleglevyeSkaNFvlikvke...daeelleallekgiivRdlksaeglleeclRitvGtree 338 rl+e++ kl gle+++S++NFvl++v + + +++ +ll++g+ivR ++++ gl +++lRit+G +ee lcl|FitnessBrowser__BFirm:BPHYT_RS14905 289 RLTEAFDKL-GLEYVPSDGNFVLVRVGNddaAGNRVNLELLKQGVIVRPVGNY-GL-PQWLRITIGLPEE 355 *********.8***************998767788999***************.85.************* PP TIGR01141 339 nerllealke 348 ne++++al++ lcl|FitnessBrowser__BFirm:BPHYT_RS14905 356 NEAFIAALER 365 *******986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (370 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.66 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory