Align Histidinol-phosphate aminotransferase; EC 2.6.1.9 (characterized, see rationale)
to candidate BPHYT_RS17705 BPHYT_RS17705 histidinol-phosphate aminotransferase
Query= uniprot:A0A2R7PAQ8 (373 letters) >FitnessBrowser__BFirm:BPHYT_RS17705 Length = 356 Score = 365 bits (937), Expect = e-105 Identities = 196/373 (52%), Positives = 260/373 (69%), Gaps = 18/373 (4%) Query: 1 MTTPASSPLQALARIRPDVRAMHSYVVQPSTGMLKMDAMENPFRLPAHLQAALGQRLGSV 60 MTTP IR DV AM SY V +TG +K+DAMENPF LP L A LG+ L V Sbjct: 1 MTTPQDI-------IRRDVLAMTSYPVPDATGYIKLDAMENPFTLPPVLAAHLGEHLAGV 53 Query: 61 ALNRYPGDRIADLKAALAQYAGMPEGYGIVLGNGSDELITLLALACAQPGTGQRATMLAP 120 ALNRYP R L + + +P G ++LGNGSDE+I+++++ACAQPG A +LAP Sbjct: 54 ALNRYPAPRPDALIEKIKRVMQVPAGCDVLLGNGSDEIISMVSVACAQPG----AKVLAP 109 Query: 121 MPGFVMYPLSAQLQGLDFVGVPLTPDFELDEPAMLAAIGQHRPAITYIAYPNNPTATLWD 180 +PGFVMY +SA+L L+F+GVPL DF LD AMLAAI +H+PAI Y+AYPNNPT TL+D Sbjct: 110 VPGFVMYQMSAKLANLEFIGVPLKADFTLDTEAMLAAIAEHQPAIIYLAYPNNPTGTLYD 169 Query: 181 EGAVQRIIDAAGAQGGIVVMDEAYQPFASRTWIDRMRAEPARNAHVLLMRTLSKFGLAGV 240 + ++RII A A +VV+DEAYQPFA ++W+ R A +V++MRT+SK GLAG+ Sbjct: 170 DADMERII--AAANKSLVVIDEAYQPFAQQSWLPRADAFD----NVVVMRTVSKLGLAGI 223 Query: 241 RLGYLIGPSAFVSEIDKVRPPYNVSVLNCEAALFALEHAEVFAAQAAEIRVERATLIAAL 300 RLGYL+G +++E DKVRPPYN +VL AA F L+H +V +QAA++R ER L A+ Sbjct: 224 RLGYLVGKPGWLTEFDKVRPPYNTNVLTQAAADFLLDHVDVLDSQAAQLREERTKLARAV 283 Query: 301 RQMPGVEKCWDSEANMVLIRVADSAKAYEGMKNRKVLVKNVSTMHPLLANCLRLTVGNAE 360 Q+PG E + S N +L+RV D++ +E + +VL+KNVS MHPLLANC+RLTVG+ E Sbjct: 284 SQLPGAE-VFPSAGNFLLVRVPDASVLFETLLTARVLIKNVSKMHPLLANCVRLTVGSPE 342 Query: 361 DNAQMLAALQASL 373 +NAQ+LA L+ L Sbjct: 343 ENAQLLAGLKLVL 355 Lambda K H 0.321 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 392 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 356 Length adjustment: 29 Effective length of query: 344 Effective length of database: 327 Effective search space: 112488 Effective search space used: 112488 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
Align candidate BPHYT_RS17705 BPHYT_RS17705 (histidinol-phosphate aminotransferase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.18587.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-97 311.6 0.0 3.2e-97 311.5 0.0 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS17705 BPHYT_RS17705 histidinol-phospha Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS17705 BPHYT_RS17705 histidinol-phosphate aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 311.5 0.0 3.2e-97 3.2e-97 2 347 .. 10 352 .. 9 354 .. 0.95 Alignments for each domain: == domain 1 score: 311.5 bits; conditional E-value: 3.2e-97 TIGR01141 2 ekikklepYqpgarelgekevvkLnsnEnPfgpsekvkealkeelk..klhrYpdpqalelkealakylg 69 +++ +++ Y + ++ +kL+++EnPf ++ + ++l e+l+ l+rYp p + +l e++ ++++ lcl|FitnessBrowser__BFirm:BPHYT_RS17705 10 RDVLAMTSYPVP----DATGYIKLDAMENPFTLPPVLAAHLGEHLAgvALNRYPAPRPDALIEKIKRVMQ 75 566666777663....22378*************************999********************* PP TIGR01141 70 vee.enillgnGsdelielliraflepgdavlvleptysmYevsakiagaevkevplkedgqedleavle 138 v + ++llgnGsde+i+++ a+++pg++vl++ p + mY++sak+a+ e + vplk+d++ d+ea+l+ lcl|FitnessBrowser__BFirm:BPHYT_RS17705 76 VPAgCDVLLGNGSDEIISMVSVACAQPGAKVLAPVPGFVMYQMSAKLANLEFIGVPLKADFTLDTEAMLA 145 765269*******************************************************9*****999 PP TIGR01141 139 .aakekvklvflasPnnPtGnllkreeiekvleevedalVVvDeAYieFseeasvlellaeypnlvvlrT 207 +a++++ +++la+PnnPtG+l + +++e++++++++ lVV+DeAY F+++ s+l+ + ++n+vv+rT lcl|FitnessBrowser__BFirm:BPHYT_RS17705 146 aIAEHQPAIIYLAYPNNPTGTLYDDADMERIIAAANKSLVVIDEAYQPFAQQ-SWLPRADAFDNVVVMRT 214 67899******************************9***************7.***************** PP TIGR01141 208 lSKafgLAglRvGyaianaeiiealekvrapynvsslaleaavaalrdsdkiektveevkkererlleel 277 +SK+ LAg+R+Gy+++++ + +++kvr+pyn+++l+++aa l++ d + ++ +++++er+ l ++ lcl|FitnessBrowser__BFirm:BPHYT_RS17705 215 VSKLG-LAGIRLGYLVGKPGWLTEFDKVRPPYNTNVLTQAAADFLLDHVDVLDSQAAQLREERTKLARAV 283 ***86.**************************************************************** PP TIGR01141 278 kkleglevyeSkaNFvlikvkedaeelleallekgiivRdlksaeglleeclRitvGtreenerllealk 347 ++l+g ev++S +NF+l++v+ da+ l+e+ll +++++++++++++ll +c+R+tvG++een +ll+ lk lcl|FitnessBrowser__BFirm:BPHYT_RS17705 284 SQLPGAEVFPSAGNFLLVRVP-DASVLFETLLTARVLIKNVSKMHPLLANCVRLTVGSPEENAQLLAGLK 352 *********************.*******************************************99775 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (356 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.28 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory