GapMind for Amino acid biosynthesis

 

Aligments for a candidate for ilvD in Burkholderia phytofirmans PsJN

Align Dihydroxy-acid dehydratase; DAD; EC 4.2.1.9 (uncharacterized)
to candidate BPHYT_RS19730 BPHYT_RS19730 dihydroxy-acid dehydratase

Query= curated2:A8AB39
         (552 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS19730 BPHYT_RS19730
           dihydroxy-acid dehydratase
          Length = 577

 Score =  396 bits (1017), Expect = e-114
 Identities = 225/546 (41%), Positives = 334/546 (61%), Gaps = 17/546 (3%)

Query: 15  HRALWRASGLIDEELR-RPLIGVANSWNEIVPGHVHLDKVAEAVKAGIRMAGGTPLEFGT 73
           HR+  +  G+  +E   RP+IG+ N+W+E+ P + H  ++AE VK G+  AGG PLEF  
Sbjct: 27  HRSWMKNQGIPHDEFDGRPVIGICNTWSELTPCNAHFRELAEYVKKGVHEAGGLPLEFPV 86

Query: 74  IAVCDGIAMGHEGMR-YSLPSREVIADTVEIMVEAHRLDAVVMVTNCDKITPGFLLAAAR 132
           ++      +G   +R  ++  R + +  VE  +  + +D V+++  CDK TP  L+ AA 
Sbjct: 87  MS------LGETNLRPTAMLFRNLASMDVEESIRGNPMDGVILLVGCDKTTPALLMGAAS 140

Query: 133 LEVPVILINGGPMMPGVYGKERIDFKDLMERMNVLIKEGRT--EELRKLEESALPGPGSC 190
             +P + ++GGPM+ G +  + I     + +M+  ++ G    EE  + E       G C
Sbjct: 141 CNLPALAVSGGPMLNGRFRGKNIGSGTGVWQMSEEVRAGTMTQEEFTEAESCMNRSRGHC 200

Query: 191 AGLFTANTMNMLSEAMGLMLPGASTVPAVEARRLWYAKLTGMRIVKMVEEGLTPDKILTR 250
             + TA+TM  + E++G+ LP  + +PAV+ARR   A L G RIV MV E LT DKILTR
Sbjct: 201 MTMGTASTMASMVESLGMGLPHNAAIPAVDARRQVLAHLAGRRIVDMVREDLTMDKILTR 260

Query: 251 KALENAIAVDMALGGSTNSVLHLEALAYELGIDLPLEVFDEISRKVPHIASISPSGRHFV 310
           +A ENAI  + A+GGSTN+V+HL ALA  +G++L LE + E+   VP + ++ PSG + +
Sbjct: 261 QAFENAIRTNAAIGGSTNAVVHLIALAKRIGVELSLEDW-ELGSNVPCLVNLQPSGEYLM 319

Query: 311 VDLDRAGGIPAVLKELGEAGLIHKDALTVTGKTVWENVKDAAVLDREVIRPLDNPYSPFG 370
            D   AGG+PAVLK+LGE GL+HK+ALTV GKT+W+NV++AA  D +VI     P+ P  
Sbjct: 320 EDFYYAGGLPAVLKQLGEQGLLHKEALTVNGKTLWDNVRNAANYDEKVITTFAEPFKPKA 379

Query: 371 GLAILKGSLAPNGAVVKASAVKRELWKFKGVARVFDREEDAVKAI--RGGEIEPGTVIVI 428
           G+A+LKG+LAPNGAV+K SA    L K +G A VF+  E+    I     +I+   ++V+
Sbjct: 380 GIAVLKGNLAPNGAVIKPSAATASLLKHRGRAVVFENIEELHAKIDDESLDIDEHCIMVL 439

Query: 429 RYEGPRGGPGMREM--LTATAAVMALGLGDKVALVTDGRFSGATRGPAIGHVSPEAAAGG 486
           +  GP+G PG  E+  +     V+  G+ D V  ++DGR SG   G  + HVSPEAAAGG
Sbjct: 440 KGAGPKGYPGFAEVGNMPLPKKVLQKGITDMVR-ISDGRMSGTAYGAVVLHVSPEAAAGG 498

Query: 487 PIALVQDGDEIVIDIEKRRLDLLVDEKELEERRARWKPKVKPLRRGILRRYAKMALSADK 546
           P+A VQ GD I +D+E+RRL L V ++EL  RRA W+    P +RG  + Y +  L AD+
Sbjct: 499 PLAFVQTGDMIELDVEERRLHLDVTDEELARRRAAWQAPEAP-KRGYYKLYVEHVLQADQ 557

Query: 547 GGALEY 552
           G  L++
Sbjct: 558 GADLDF 563


Lambda     K      H
   0.319    0.138    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 817
Number of extensions: 34
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 552
Length of database: 577
Length adjustment: 36
Effective length of query: 516
Effective length of database: 541
Effective search space:   279156
Effective search space used:   279156
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory