Align Succinyl-diaminopimelate desuccinylase 2; SDAP desuccinylase 2; EC 3.5.1.18; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase 2 (uncharacterized)
to candidate BPHYT_RS09285 BPHYT_RS09285 acetylornithine deacetylase
Query= curated2:Q1GMM6 (395 letters) >FitnessBrowser__BFirm:BPHYT_RS09285 Length = 404 Score = 82.4 bits (202), Expect = 2e-20 Identities = 70/219 (31%), Positives = 96/219 (43%), Gaps = 18/219 (8%) Query: 60 NLFAIWGEDRNGRTFG---FNGHTDVVPIGDPKDWTVDPFGAEIRDGILYGRGSTDMKSG 116 NLFA NG T G +GHTDVVP+ D + W DPF EIR LYGRG+ DMK Sbjct: 65 NLFATIPA-HNGETNGGVVLSGHTDVVPV-DGQQWDSDPFKPEIRGDKLYGRGTCDMKGF 122 Query: 117 VAAFAAAAIEFVNETPPDGRVIIAITGAEETGSPDGTRAIVQWMEANDIRADHFIVGEPT 176 + A A + + T + A++ EE G I M+ ++ D IVGEPT Sbjct: 123 IGA-ALTLVPEMQRTKLAKPIHFALSFDEEVGCAGAPLLIADLMK-RGVKPDGCIVGEPT 180 Query: 177 SLKSIGDAIKIGRRGTITVFLTVTGVQGHSGYPEKANNPL---PALVDLLQGFGQAAMDE 233 S++ I + +G V G HS K N + L+ ++ ++ Sbjct: 181 SMRPI-----VAHKGINAYQCCVRGQAAHSSLTPKGLNAIEYAARLICYIRDMADQFREQ 235 Query: 234 G---TEFFAPSTLAITTIDTGNPARNVIPATCKATLSIR 269 G + P T A T+ G A N +PA CK R Sbjct: 236 GPFDELYDVPFTTAQTSTIVGGNAINTVPAECKFQFEFR 274 Lambda K H 0.318 0.135 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 366 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 404 Length adjustment: 31 Effective length of query: 364 Effective length of database: 373 Effective search space: 135772 Effective search space used: 135772 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory