Align Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 (characterized)
to candidate BPHYT_RS35090 BPHYT_RS35090 diaminopimelate decarboxylase
Query= SwissProt::E0IWI3 (420 letters) >lcl|FitnessBrowser__BFirm:BPHYT_RS35090 BPHYT_RS35090 diaminopimelate decarboxylase Length = 413 Score = 532 bits (1371), Expect = e-156 Identities = 254/405 (62%), Positives = 323/405 (79%), Gaps = 2/405 (0%) Query: 15 ENLLRLPAEFGCPVWVYDAQIIRRQIAALKQFDVVRFAQKACSNIHILRLMREQGVKVDS 74 + L+ L E G P+WVYDA IRR+IA L+ FDV+R+AQKACSN+HIL+LMR++G VD+ Sbjct: 6 QQLVELAHEHGTPLWVYDADTIRRRIAELRSFDVIRYAQKACSNLHILKLMRDEGAMVDA 65 Query: 75 VSLGEIERALAAGYNPQTHPDDIVFTADVIDQATLERVSELQIPVNAGSVDMLDQLGQVS 134 VSLGEI+R+LAAG+ P P+ +VFTAD+ID ATL V E +I VNAGS+DML+Q+G+ + Sbjct: 66 VSLGEIKRSLAAGFKPDGDPEGVVFTADLIDHATLATVIEHRITVNAGSLDMLEQIGRHA 125 Query: 135 P-GHRVWLRVNPGFGHGHSQKTNTGGENSKHGIWYTDLPAALDVIQRHHLQLVGIHMHIG 193 P GHRVWLR+NPGFGHGHS KTNTGGE+SKHGIW D+P A+++++R+ L+LVG+HMHIG Sbjct: 126 PEGHRVWLRINPGFGHGHSNKTNTGGEHSKHGIWLDDVPRAVELVRRYRLKLVGLHMHIG 185 Query: 194 SGVDYAHLEQVCGAMVRQVIEFGQDLQAISAGGGLSVPYQQGEEAVDTEHYYGLWNAARE 253 SGVDY HL +VC AMV V G D++AISAGGGLSVPY++GE +D HY+ LW+AAR Sbjct: 186 SGVDYGHLSRVCEAMVEAVKGLGHDIEAISAGGGLSVPYREGEPDIDVAHYFRLWDAARR 245 Query: 254 QIARHLGHPVKLEIEPGRFLVAQSGVLITQVRSVKQMGSRHFVLVDAGFNDLMRPAMYGS 313 QI H+GH V+LEIEPGRFLVAQSGVL+ +V ++ + ++ F L+DAGFNDL+RP+ YGS Sbjct: 246 QIETHVGHRVRLEIEPGRFLVAQSGVLVAEVHALNRRPAQQFALLDAGFNDLVRPSFYGS 305 Query: 314 YHHISALAADGRSLEHAPTVETVVAGPLCESGDVFTQQEGGNVETRALPEVKAGDYLVLH 373 +H ++ L DG +L AP VAGPLCE+GDVFTQ E G + R++ + GD++V H Sbjct: 306 HHEMTVLRRDG-ALSEAPIDSFAVAGPLCEAGDVFTQAESGVITNRSIHTPEVGDFIVFH 364 Query: 374 DTGAYGASMSSNYNSRPLLPEVLFDNGQARLIRRRQTIEELLALE 418 D GAYGASMSSNYNSRPL PEVL D+G+ RLIRRRQTI+ELLALE Sbjct: 365 DAGAYGASMSSNYNSRPLAPEVLLDHGKPRLIRRRQTIDELLALE 409 Lambda K H 0.320 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 621 Number of extensions: 33 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 420 Length of database: 413 Length adjustment: 31 Effective length of query: 389 Effective length of database: 382 Effective search space: 148598 Effective search space used: 148598 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate BPHYT_RS35090 BPHYT_RS35090 (diaminopimelate decarboxylase)
to HMM TIGR01048 (lysA: diaminopimelate decarboxylase (EC 4.1.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01048.hmm # target sequence database: /tmp/gapView.18371.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01048 [M=417] Accession: TIGR01048 Description: lysA: diaminopimelate decarboxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-122 394.2 0.0 3.2e-122 393.9 0.0 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS35090 BPHYT_RS35090 diaminopimelate de Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS35090 BPHYT_RS35090 diaminopimelate decarboxylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 393.9 0.0 3.2e-122 3.2e-122 15 416 .. 7 409 .. 2 410 .. 0.95 Alignments for each domain: == domain 1 score: 393.9 bits; conditional E-value: 3.2e-122 TIGR01048 15 dlkelaeefgtPlYvydeetlrerlealkeafkaeeslvlYAvKAnsnlavlrllaeeGlgldvvsgGEl 84 +l ela+e+gtPl+vyd++t+r+r+++l++++ ++ YA+KA+snl++l+l+++eG+ +d+vs GE+ lcl|FitnessBrowser__BFirm:BPHYT_RS35090 7 QLVELAHEHGTPLWVYDADTIRRRIAELRSFD-----VIRYAQKACSNLHILKLMRDEGAMVDAVSLGEI 71 7899************************9887.....79******************************* PP TIGR01048 85 eralaAgvk....aekivfsgngkseeeleaaleleiklinvdsveelelleeiakelgkkarvllRvnp 150 +r laAg+k +e +vf+++ +++++l++++e++i+ +n++s+++le++ + a+e rv+lR+np lcl|FitnessBrowser__BFirm:BPHYT_RS35090 72 KRSLAAGFKpdgdPEGVVFTADLIDHATLATVIEHRIT-VNAGSLDMLEQIGRHAPEG---HRVWLRINP 137 ********9889899**********************8.******************9...9******** PP TIGR01048 151 dvdaktheyisTGlkesKFGieveeaeeayelalkleslelvGihvHIGSqildlepfveaaekvvklle 220 ++++ ++++++TG ++sK+Gi++++ +a+el+ + + l+lvG+h+HIGS++++ + + + ++v ++ lcl|FitnessBrowser__BFirm:BPHYT_RS35090 138 GFGHGHSNKTNTGGEHSKHGIWLDDVPRAVELVRRYR-LKLVGLHMHIGSGVDYGHLSRVCEAMV-EA-- 203 ************************9999998887766.**************9988766665544.44.. PP TIGR01048 221 elkeegieleeldlGGGlgisyeeeeeapdleeyaeklleklekea.elglklklilEpGRslvanagvl 289 +k g ++e++++GGGl+++y+e e +d+++y + + ++ ++ ++g++++l +EpGR+lva++gvl lcl|FitnessBrowser__BFirm:BPHYT_RS35090 204 -VKGLGHDIEAISAGGGLSVPYREGEPDIDVAHYFRLWDAARRQIEtHVGHRVRLEIEPGRFLVAQSGVL 272 .4446**************************************9999*********************** PP TIGR01048 290 ltrVesvKevesrkfvlvDagmndliRpalYeayheiaalkr...leeeetetvdvvGplCEsgDvlakd 356 +++V+++ +++ ++f+l Dag+ndl+Rp+ Y++ he+++l+r l+e++ + v+GplCE+gDv+++ lcl|FitnessBrowser__BFirm:BPHYT_RS35090 273 VAEVHALNRRPAQQFALLDAGFNDLVRPSFYGSHHEMTVLRRdgaLSEAPIDSFAVAGPLCEAGDVFTQA 342 ****************************************98887889999999***************9 PP TIGR01048 357 .......relpeveeGdllavasaGAYgasmssnYnsrprpaevlveegkarlirrretledllale 416 r++ + e Gd+++ ++aGAYgasmssnYnsrp + evl+++gk rlirrr+t+++llale lcl|FitnessBrowser__BFirm:BPHYT_RS35090 343 esgvitnRSIHTPEVGDFIVFHDAGAYGASMSSNYNSRPLAPEVLLDHGKPRLIRRRQTIDELLALE 409 9999999*********************************************************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (417 nodes) Target sequences: 1 (413 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.02s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 6.94 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory