GapMind for Amino acid biosynthesis

 

Alignments for a candidate for asd-S-perS in Burkholderia phytofirmans PsJN

Align UPF0280 protein MA_1715 (characterized, see rationale)
to candidate BPHYT_RS21475 BPHYT_RS21475 hypothetical protein

Query= uniprot:Y1715_METAC
         (253 letters)



>FitnessBrowser__BFirm:BPHYT_RS21475
          Length = 312

 Score = 63.5 bits (153), Expect = 5e-15
 Identities = 41/129 (31%), Positives = 66/129 (51%), Gaps = 13/129 (10%)

Query: 91  IGPMSAVAGTISALAVEAMVKAGAKYAIVDNGGDIA--LINDRSVVVGIYA--------- 139
           I PM+AVAG+++   + A  + G   A V+NGGDIA  L   +   VG++A         
Sbjct: 93  ITPMAAVAGSVADELITAFAREGVSRAFVNNGGDIALYLTEGQQYRVGVFADLASFSAVR 152

Query: 140 -GQSPIKNLGLIFEPRDSITGVCTSAGTVGPSISFGMADAAAIFSDDVSLADAAATALGN 198
             +    +  L  +   ++ G+ TS G  G S S G+AD+  + + + + ADAAAT + N
Sbjct: 153 LSRDQALDANLTLDASLAVRGIATS-GWRGRSFSLGIADSVTVLARNAAAADAAATVIAN 211

Query: 199 EVGIGKEAV 207
            V +  E +
Sbjct: 212 AVDLDHEGI 220


Lambda     K      H
   0.317    0.133    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 152
Number of extensions: 7
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 253
Length of database: 312
Length adjustment: 26
Effective length of query: 227
Effective length of database: 286
Effective search space:    64922
Effective search space used:    64922
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 47 (22.7 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory