Align O-succinylhomoserine sulfhydrylase; OSH sulfhydrylase; OSHS sulfhydrylase; EC 2.5.1.- (characterized)
to candidate BPHYT_RS33835 BPHYT_RS33835 O-succinylhomoserine sulfhydrylase
Query= SwissProt::P55218 (403 letters) >FitnessBrowser__BFirm:BPHYT_RS33835 Length = 396 Score = 451 bits (1159), Expect = e-131 Identities = 221/389 (56%), Positives = 294/389 (75%), Gaps = 6/389 (1%) Query: 19 FDTLAVRAGQRRTPEGEHGEALFTTSSYVFRTAADAAARFAGEVPGNVYSRYTNPTVRTF 78 FDTLAVR+G R+ EH EA+F TSS+VF +AADAA +F YSR+TNPTV F Sbjct: 7 FDTLAVRSGTVRSDFNEHSEAIFLTSSFVFESAADAAEKFKNSEDNYTYSRFTNPTVSMF 66 Query: 79 EERIAALEGAEQAVATASGMSAILALVMSLCSSGDHVLVSRSVFGSTISLFDKYFKRFGI 138 ++R+AALEG E +ATASGM+AI+++VMS +GDH++ S+++FGST+ +F + F +FGI Sbjct: 67 QDRLAALEGGEACMATASGMAAIMSVVMSTLQAGDHLVSSQALFGSTLGMFSQIFSKFGI 126 Query: 139 QVDYPPLSDLAAWEAACKPNTKLFFVESPSNPLAELVDIAALAEIAHAKGALLAVDNCFC 198 + +DL AW+ A +P TK+FF+E+PSNPL E+ DI A+++IA+A AL VDNCFC Sbjct: 127 TTTFVDPTDLDAWKNAVRPETKMFFLETPSNPLTEVADIEAISKIANASNALFVVDNCFC 186 Query: 199 TPALQQPLKLGADVVIHSATKYIDGQGRGMGGVVAGRGE-QMKEVVGFLRTAGPTLSPFN 257 +PALQQPLKLGADVV+HSATK++DGQGR +GG + G + M++V F+R+AGPTLS FN Sbjct: 187 SPALQQPLKLGADVVMHSATKFLDGQGRVLGGALVGSKQFIMEKVFPFVRSAGPTLSAFN 246 Query: 258 AWLFLKGLETLRIRMQAHSASALALAEWLERQPGIERVYYAGLPSHPQHELARRQQSGFG 317 AW+ LKG+ETL +R++ SA+AL +A WLE P + RV+Y GL SHPQH LA RQQ G Sbjct: 247 AWVLLKGMETLSLRVEKQSANALEIARWLEAHPAVNRVFYPGLESHPQHALAMRQQKAGG 306 Query: 318 AVVSFDVKGG-----RDAAWRFIDATRMVSITTNLGDTKTTIAHPATTSHGRLSPEDRAR 372 A++SF++KG R AWR ID T++ SIT NLGDT+TTI HPATT+HGR++PE RA Sbjct: 307 AILSFELKGDTPEQMRANAWRVIDNTKICSITGNLGDTRTTITHPATTTHGRVTPEARAA 366 Query: 373 AGIGDSLIRVAVGLEDLDDLKADMARGLA 401 AGI + LIR+AVGLE+ D++ D+ RGLA Sbjct: 367 AGISEGLIRLAVGLENAGDIRGDLERGLA 395 Lambda K H 0.319 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 438 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 396 Length adjustment: 31 Effective length of query: 372 Effective length of database: 365 Effective search space: 135780 Effective search space used: 135780 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory