Align acetylornithine aminotransferase (EC 2.6.1.11); succinylornithine aminotransferase (EC 2.6.1.81) (characterized)
to candidate BPHYT_RS07695 BPHYT_RS07695 acetylornithine aminotransferase
Query= reanno::Marino:GFF3099 (404 letters) >FitnessBrowser__BFirm:BPHYT_RS07695 Length = 411 Score = 498 bits (1283), Expect = e-145 Identities = 239/402 (59%), Positives = 309/402 (76%), Gaps = 1/402 (0%) Query: 1 MNKEPVSRELFDEVMVPNYAPGSIIPVRGEGSRIWDQEGREFIDLQGGIAVTCLGHSHPG 60 MN V+R+ FDEVMVP ++P + +P RG GSR+WD +GR++ID GGIAVT LGH+HP Sbjct: 1 MNDLTVTRQTFDEVMVPVFSPAAFVPDRGLGSRVWDTQGRDYIDFAGGIAVTALGHAHPE 60 Query: 61 LVGALHDQAEKIWHLSNVMTNEPALRLAKTLCDLTFAERVFFANSGAEANEAAFKLARRY 120 L+ LH+Q K+WH+ N TNEP LRLAK L DLTFA+R FFANSGAEANEAA KLARR Sbjct: 61 LLNVLHEQGGKLWHIGNGYTNEPVLRLAKRLEDLTFADRAFFANSGAEANEAALKLARRV 120 Query: 121 AWEHHGKEKNEIISFKNSFHGRTLFTVSVGGQPKYLEGFEPAPGGIHHAEFNDLESVKKL 180 A++ HG +K EIISF SFHGRT FTVSVGGQPKY EGF P P GI H +ND+E+VKK Sbjct: 121 AFDRHGADKYEIISFTQSFHGRTFFTVSVGGQPKYSEGFGPVPAGITHLPYNDIEAVKKA 180 Query: 181 ISKEKTCAIVVEPIQGEGGVMPGDQAFLQGLRDLCDENDALLVFDEVQSGVGRSGHFYAY 240 I + TCA++VEPIQGEGGV+P D AFL+ LR+ CD++ ALL+FDEVQ+GVGRSG+FYAY Sbjct: 181 IGAQ-TCAVIVEPIQGEGGVIPADPAFLKALREACDQHGALLIFDEVQTGVGRSGYFYAY 239 Query: 241 QMYGVVPDILSSAKGLGGGFPVAAMLTTAKVAASLGVGTHGSTYGGNALACAVAQRVVDT 300 Q GV PDIL++AK LG GFP+ AMLTT ++AA VG HG+TYGGN L A+A++VV+ Sbjct: 240 QETGVTPDILTTAKALGNGFPIGAMLTTNELAAYFKVGVHGTTYGGNPLGAAIAEKVVEL 299 Query: 301 VSQPEILKGVKARSDKLRKGMMDIGERYGVFTEVRGAGLLLGCVLTEKWQGKAKDFLNAG 360 VS P++L+GV++RS+ L+ + + ER+G+FTEVRG GLL+G L E ++G+AKDF+ A Sbjct: 300 VSDPKLLEGVRSRSEALKGHLAKLNERFGLFTEVRGRGLLIGAELNEAFKGRAKDFVTAA 359 Query: 361 LEEGVMVLVAGANVIRLAPSLIIPEPDIELALERFEAAVKKL 402 + GV++L+AG +V+R PSLI+P D+ ER A++ + Sbjct: 360 GQHGVIMLMAGPDVLRFVPSLIMPLDDMNEGFERLAKAIESI 401 Lambda K H 0.318 0.137 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 556 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 404 Length of database: 411 Length adjustment: 31 Effective length of query: 373 Effective length of database: 380 Effective search space: 141740 Effective search space used: 141740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory