Align Phosphoserine phosphatase SerB1; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 (characterized)
to candidate BPHYT_RS02470 BPHYT_RS02470 phosphoserine phosphatase
Query= SwissProt::P9WGJ3 (308 letters) >FitnessBrowser__BFirm:BPHYT_RS02470 Length = 227 Score = 91.3 bits (225), Expect = 2e-23 Identities = 76/223 (34%), Positives = 98/223 (43%), Gaps = 16/223 (7%) Query: 59 AFFDVDNTLVQGSSA---VHFGRGLAARHYFTYRDVLGFLYAQAKFQLLGKENSNDVAAG 115 A FD+D+TL+ S HF GL + + Y Q L D+AA Sbjct: 6 ALFDLDHTLLPLDSDQAWAHFIAGLGIEGAARHAQEIDDYYQQYVAGTL------DMAAY 59 Query: 116 RRKALAFIEGRSVAELVALGEEIYDEIIADKIWDGTRELTQMHLDAGQQVWLITATPYEL 175 LA + S +L + ++IA I TR L Q HLDAG ++TAT + Sbjct: 60 LNYTLAPLARHSREQLDTWHAQFMQQVIAPAILPATRALVQRHLDAGDLCCIVTATNVFI 119 Query: 176 AATIARRLGLTGALGTVAESVDGI----FTGRLVGEILHGTGKAHAVRSLAIREGLNLK- 230 I + LG LG + G FTG+ VG GK S G L+ Sbjct: 120 TEPIGKALGFEHLLGIELGTEGGDPLARFTGKAVGTPTFREGKITRTESWLTSLGHRLQD 179 Query: 231 --RCTAYSDSYNDVPMLSLVGTAVAINPDARLRSLARERGWEI 271 + YSDS NDVP+L V VA NPDARLR +A ERGW + Sbjct: 180 FPQSWFYSDSINDVPLLERVTNPVATNPDARLRVIATERGWPV 222 Lambda K H 0.319 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 227 Length adjustment: 25 Effective length of query: 283 Effective length of database: 202 Effective search space: 57166 Effective search space used: 57166 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory