Align Tryptophan synthase beta chain 1; EC 4.2.1.20 (characterized, see rationale)
to candidate BPHYT_RS33875 BPHYT_RS33875 tryptophan synthase subunit alpha
Query= uniprot:P50383 (425 letters) >FitnessBrowser__BFirm:BPHYT_RS33875 Length = 397 Score = 124 bits (312), Expect = 4e-33 Identities = 111/372 (29%), Positives = 164/372 (44%), Gaps = 50/372 (13%) Query: 61 IPEEVRDRYLSIGRPTPLFRAKRLEEYLKTPARIYFKYEGATPTGSHKINTAIPQAYFAK 120 + E R+ +GRP+P++ A+R E L A+I+ K E TG+HK+N I QA AK Sbjct: 44 VAEYERELKYFVGRPSPIYHAQRWSEMLGG-AQIFLKREDLNHTGAHKVNNVIGQALLAK 102 Query: 121 EEGIEHVVTETGAGQWGTAVALAASMYNMKSTIFMVKVSYEQKPMRRSIMQLYGANVYAS 180 G V+ ETGAGQ G A A A+ + M+ ++M ++ M+L GA V Sbjct: 103 RMGKPRVIAETGAGQHGVATATIAARFGMECVVYMGSEDVRRQAANVYRMKLLGATVVP- 161 Query: 181 PTNLTEYGRKILETNPQHPGSLGIAMSEAIEYALKNEFRYLVGSVLD------VVLLHQS 234 E G + L+ +L AM + + ++N F Y++G+V +V Q Sbjct: 162 ----VESGSRTLK------DALNEAMRDWVT-NVENTF-YIIGTVAGPHPYPMMVRDFQR 209 Query: 235 VIGQETITQL-DLLGEDADILIGCVGGGSNFGGFTYPFIGNKKGK--------------R 279 VIG E Q+ +L+G D +I CVGGGSN G YP+I + K R Sbjct: 210 VIGDECKVQMPELVGRQPDAVIACVGGGSNAMGIFYPYIDDTSVKLIGVEAAGDGIESGR 269 Query: 280 YIAVSSAEIPKFSKGEYKYDFPDSAGLLPLVKMITLGKDYVPPPIYAGGLRYHGVAPTLS 339 + A P G Y D G + + + GL Y GV P + Sbjct: 270 HAASLIGGSPGVLHGNRTYLLQDENGQI------------IETHSVSAGLDYPGVGPEHA 317 Query: 340 LLTKEGIVEWREYNEREIFEAAKIFIENQGIVPAPESAHAIRAVVDEAIEARKNNERKVI 399 L E+ + E +A +GI+PA ES+HA+ A K+ K + Sbjct: 318 WLKDSKRAEYVGITDEEALKAFHDCCRIEGIIPALESSHALAYAAKLAPTLPKD---KYL 374 Query: 400 VFNLSGHGLLDL 411 + NLSG G D+ Sbjct: 375 LVNLSGRGDKDM 386 Lambda K H 0.318 0.138 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 386 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 397 Length adjustment: 31 Effective length of query: 394 Effective length of database: 366 Effective search space: 144204 Effective search space used: 144204 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate BPHYT_RS33875 BPHYT_RS33875 (tryptophan synthase subunit alpha)
to HMM TIGR00263 (trpB: tryptophan synthase, beta subunit (EC 4.2.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00263.hmm # target sequence database: /tmp/gapView.20766.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00263 [M=385] Accession: TIGR00263 Description: trpB: tryptophan synthase, beta subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-197 641.9 0.1 2.1e-197 641.7 0.1 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS33875 BPHYT_RS33875 tryptophan synthas Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS33875 BPHYT_RS33875 tryptophan synthase subunit alpha # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 641.7 0.1 2.1e-197 2.1e-197 1 384 [. 9 392 .. 9 393 .. 1.00 Alignments for each domain: == domain 1 score: 641.7 bits; conditional E-value: 2.1e-197 TIGR00263 1 gkfgefGGqyvpevllealeelekayekakkdeefkkeleellkeyagrptpltfaknlskklggakiyl 70 g+fg+fGG +v+e+l++al+el++ay+k+k+d++f++e+e+ lk ++grp+p+++a++ s+ lgga+i+l lcl|FitnessBrowser__BFirm:BPHYT_RS33875 9 GHFGQFGGVFVAETLVHALDELRAAYDKYKQDPAFVAEYERELKYFVGRPSPIYHAQRWSEMLGGAQIFL 78 68******************************************************************** PP TIGR00263 71 kredllhtGahkinnalgqallakrlGkkriiaetGaGqhGvatataaallglecevymGaedverqkln 140 kredl+htGahk+nn++gqallakr+Gk r+iaetGaGqhGvatat+aa++g+ec+vymG+edv rq+ n lcl|FitnessBrowser__BFirm:BPHYT_RS33875 79 KREDLNHTGAHKVNNVIGQALLAKRMGKPRVIAETGAGQHGVATATIAARFGMECVVYMGSEDVRRQAAN 148 ********************************************************************** PP TIGR00263 141 vfrmellgakvvpvtsGsktlkdavnealrdWvtsvedthyvlGsavGphPfPeivrefqsvigeevkeq 210 v+rm+llga+vvpv+sGs+tlkda+nea+rdWvt+ve+t+y++G+++GphP+P +vr+fq+vig+e+k q lcl|FitnessBrowser__BFirm:BPHYT_RS33875 149 VYRMKLLGATVVPVESGSRTLKDALNEAMRDWVTNVENTFYIIGTVAGPHPYPMMVRDFQRVIGDECKVQ 218 ********************************************************************** PP TIGR00263 211 ilekegrlPdaviacvGGGsnaiGifaafiedeeveligveagGkGidtekhaatlskGkeGvlhGaktk 280 + e gr PdaviacvGGGsna+Gif+++i+d +v+ligvea+G Gi++ +haa+l G++GvlhG++t+ lcl|FitnessBrowser__BFirm:BPHYT_RS33875 219 MPELVGRQPDAVIACVGGGSNAMGIFYPYIDDTSVKLIGVEAAGDGIESGRHAASLIGGSPGVLHGNRTY 288 ********************************************************************** PP TIGR00263 281 llqdedGqieeahsvsaGldypgvgPehaalaetgraeyeaitdeealealkllskeeGiipalesshal 350 llqde+Gqi e+hsvsaGldypgvgPeha+l++++raey+ itdeeal+a++ +++ eGiipalesshal lcl|FitnessBrowser__BFirm:BPHYT_RS33875 289 LLQDENGQIIETHSVSAGLDYPGVGPEHAWLKDSKRAEYVGITDEEALKAFHDCCRIEGIIPALESSHAL 358 ********************************************************************** PP TIGR00263 351 aaleklapklkkdeivvvnlsGrGdkdletvaka 384 a++ klap+l+kd+ ++vnlsGrGdkd++tva++ lcl|FitnessBrowser__BFirm:BPHYT_RS33875 359 AYAAKLAPTLPKDKYLLVNLSGRGDKDMHTVAER 392 *******************************985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (397 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 12.27 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory