Align Anthranilate synthase component 2; AS; ASII; Anthranilate synthase, GATase component; Anthranilate synthase, glutamine amidotransferase component; EC 4.1.3.27 (characterized)
to candidate BPHYT_RS17395 BPHYT_RS17395 anthranilate synthase subunit II
Query= SwissProt::P20576 (201 letters) >FitnessBrowser__BFirm:BPHYT_RS17395 Length = 200 Score = 254 bits (649), Expect = 7e-73 Identities = 126/192 (65%), Positives = 150/192 (78%), Gaps = 5/192 (2%) Query: 1 MLLMIDNYDSFTYNLVQYFGELKAEVKVVRNDELSVEQIEALAPERIVLSPGPCTPNEAG 60 MLLMIDNYDSFTYNLVQYFGEL +V+ RNDE+++++I L PERI LSPGP P AG Sbjct: 1 MLLMIDNYDSFTYNLVQYFGELGEDVRTYRNDEITLDEIAKLNPERICLSPGPSNPQHAG 60 Query: 61 VSLAVIERFAGKLPLLGVCLGHQSIGQAFGGEVVRARQVMHGKTSPIHHKDLGVFAGLAN 120 ++L V+ F+GK P+LGVCLGHQ+IG+AFGG VVRA+ +MHGK S I GVFA L Sbjct: 61 ITLDVLREFSGKTPILGVCLGHQAIGEAFGGRVVRAQTIMHGKVSTIETDCKGVFADLPK 120 Query: 121 PLTVTRYHSLVVKRESLPECLEVTAWTQHADGSLDEIMGVRHKTLNVEGVQFHPESILTE 180 VTRYHSL ++RESLP+CLEV+AWT+ DG EIMGVRHK L VEGVQFHPESIL+E Sbjct: 121 HFVVTRYHSLAIERESLPDCLEVSAWTE--DG---EIMGVRHKELAVEGVQFHPESILSE 175 Query: 181 QGHELLANFLRQ 192 GH LL NF++Q Sbjct: 176 HGHALLENFVKQ 187 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 201 Length of database: 200 Length adjustment: 21 Effective length of query: 180 Effective length of database: 179 Effective search space: 32220 Effective search space used: 32220 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
Align candidate BPHYT_RS17395 BPHYT_RS17395 (anthranilate synthase subunit II)
to HMM TIGR00566 (glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase)
../bin/blast/fastacmd -i /tmp/list.12550.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.12550.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.