GapMind for Amino acid biosynthesis

 

Aligments for a candidate for cmutase in Burkholderia phytofirmans PsJN

Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate BPHYT_RS14910 BPHYT_RS14910 chorismate mutase

Query= SwissProt::P27603
         (365 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS14910 BPHYT_RS14910 chorismate
           mutase
          Length = 360

 Score =  327 bits (839), Expect = 2e-94
 Identities = 172/358 (48%), Positives = 242/358 (67%), Gaps = 6/358 (1%)

Query: 6   QLKALRVRIDSLDERILDLISERARCAQEVARVKTASWPKAEEAVFYRPEREAWVLKHIM 65
           +LK LR RID+LD +++ L+++RA  A EV  VK     K   A  +RPERE  V+  + 
Sbjct: 8   RLKPLRERIDALDAQLIALLNQRAAVALEVGEVK-----KHFNAPVFRPEREQQVIARLQ 62

Query: 66  ELNKGPLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVISKPMA 125
           ++++GPL +E ++ ++REIM++  ALE+ ++ AYLGP GT+S+ A  ++FG S+   P  
Sbjct: 63  DMSEGPLASEHISAIWREIMAASRALEKTIKAAYLGPVGTYSEQAMHEYFGQSIEGLPCP 122

Query: 126 AIDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLLVGET 185
           +IDEVFR V AGA  FGVVPVENSTEGAV+ TLD  L+  + I GE+ L IHH+LL    
Sbjct: 123 SIDEVFRSVEAGAAEFGVVPVENSTEGAVSRTLDLLLQTQLTIGGELALPIHHNLLTLNG 182

Query: 186 TKTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAGDMAA 245
             T  +TR+ +HAQ+LAQC++WL  + P++ER AVSSNA+AA+    +   AAIAGD AA
Sbjct: 183 GLTG-VTRVCAHAQALAQCQRWLSTNAPHLERQAVSSNAEAARMAAEDPTVAAIAGDRAA 241

Query: 246 QLYGLSKLAEKIEDRPVNSTRFLIIGSQEVPPTGDDKTSIIVSMRNKPGALHELLMPFHS 305
             YGL      I+D P N TRF++IG Q   P+G D+TS+IVS+ N+PGA+ +LL P   
Sbjct: 242 THYGLQVAYALIQDDPHNRTRFVMIGKQPAGPSGYDQTSLIVSVVNEPGAMVKLLEPLAR 301

Query: 306 NGIDLTRIETRPSRSGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGSYPKA 363
           + + +TR E+RP+R G W Y F+ID  GH  DP +   L ++G +A  LK+LGSYP+A
Sbjct: 302 HSVSMTRFESRPARVGTWEYYFYIDVEGHRDDPAVAAALTELGEKAAFLKILGSYPRA 359


Lambda     K      H
   0.319    0.133    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 330
Number of extensions: 9
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 365
Length of database: 360
Length adjustment: 29
Effective length of query: 336
Effective length of database: 331
Effective search space:   111216
Effective search space used:   111216
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate BPHYT_RS14910 BPHYT_RS14910 (chorismate mutase)
to HMM TIGR01807 (pheA: chorismate mutase (EC 5.4.99.5))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01807.hmm
# target sequence database:        /tmp/gapView.4303.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01807  [M=76]
Accession:   TIGR01807
Description: CM_P2: chorismate mutase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                -----------
    1.3e-30   91.8   0.2    2.5e-30   90.9   0.2    1.5  1  lcl|FitnessBrowser__BFirm:BPHYT_RS14910  BPHYT_RS14910 chorismate mutase


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__BFirm:BPHYT_RS14910  BPHYT_RS14910 chorismate mutase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   90.9   0.2   2.5e-30   2.5e-30       1      76 []       9      82 ..       9      82 .. 0.98

  Alignments for each domain:
  == domain 1  score: 90.9 bits;  conditional E-value: 2.5e-30
                                TIGR01807  1 LkelRnkiDaiDdrildLlseRaklakavgelKkksaseaviYRPeREaavlrrlkelnkGpLdqeavarif 72
                                             Lk+lR++iDa+D+++  Ll++Ra +a +vge+Kk+   +a+++RPeRE++v+ rl+++ +GpL +e + +i+
  lcl|FitnessBrowser__BFirm:BPHYT_RS14910  9 LKPLRERIDALDAQLIALLNQRAAVALEVGEVKKH--FNAPVFRPEREQQVIARLQDMSEGPLASEHISAIW 78
                                             89*********************************..89999****************************** PP

                                TIGR01807 73 rEim 76
                                             rEim
  lcl|FitnessBrowser__BFirm:BPHYT_RS14910 79 REIM 82
                                             ***9 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (76 nodes)
Target sequences:                          1  (360 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 10.58
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory