Align aspartate semialdehyde dehydrogenase subunit (EC 1.2.1.11) (characterized)
to candidate 353162 BT3636 aspartate-semialdehyde dehydrogenase (NCBI ptt file)
Query= metacyc::MONOMER-6564 (346 letters) >FitnessBrowser__Btheta:353162 Length = 335 Score = 327 bits (838), Expect = 3e-94 Identities = 178/344 (51%), Positives = 233/344 (67%), Gaps = 11/344 (3%) Query: 5 LHVAVVGATGAVGQQMLKTLEDRNFEMDTLTLLSSKRSAGTKVTFKGQELTVQEASP-ES 63 + VA+VG +GAVGQ+ L+ L++RNF MD L L SKRSAGT TF+G+++ V+ + Sbjct: 1 MKVAIVGVSGAVGQEFLRVLDERNFPMDELVLFGSKRSAGTTYTFRGKQIEVKLLQHNDD 60 Query: 64 FEGVNIALFSAGGSVSQALAPEAVKRGAIVIDNTSAFRMDENTPLVVPEVNEAD-LHEHN 122 F+GV+IA SAG S+ K GA++IDN+SAFRMD + PLVVPEVN AD L Sbjct: 61 FKGVDIAFTSAGAGTSKEFEKTITKYGAVMIDNSSAFRMDADVPLVVPEVNAADALERPR 120 Query: 123 GIIANPNCSTIQMVAALEPIRKAYGLNKVIVSTYQAVSGAGNEAVKELYSQTQAILNKEE 182 G+IANPNC+TIQMV AL+ I + + V VSTYQA SGAG A+ ELY Q + +L E Sbjct: 121 GVIANPNCTTIQMVVALKAIEQLSHIKTVHVSTYQAASGAGAAAMDELYEQYRQVLANE- 179 Query: 183 IEPEIMPVKGDKKHYQIAFNAIPQIDKFQDNGYTFEEMKMINETKKIMHMPDLQVAATCV 242 PV +K YQ+AFN IPQID F +NGYT EEMKM NET+KIMH D++V+ATCV Sbjct: 180 ------PVTVEKFAYQLAFNLIPQIDVFTENGYTKEEMKMYNETRKIMHS-DVKVSATCV 232 Query: 243 RLPIQTGHSESVYIEIDRDDATVEDIKNLLKEAPGVTLQDDPSQQLYPMPADAVGKNDVF 302 R+P HSES+++E +R +VE+ + + G+ LQD+P+++ YPMP GK+ V+ Sbjct: 233 RVPALRAHSESIWVETERP-ISVEEAREAFAKGEGLVLQDNPAEKEYPMPLFLAGKDPVY 291 Query: 303 VGRIRKDLDRANGFHLWVVSDNLLKGAAWNSVQIAESLKKLNLV 346 VGRIRKDL NG W+V D + KGAA N+VQIAE L K+ V Sbjct: 292 VGRIRKDLTNENGLTFWIVGDQIKKGAALNAVQIAEYLIKVKNV 335 Lambda K H 0.314 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 315 Number of extensions: 13 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 346 Length of database: 335 Length adjustment: 28 Effective length of query: 318 Effective length of database: 307 Effective search space: 97626 Effective search space used: 97626 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
Align candidate 353162 BT3636 (aspartate-semialdehyde dehydrogenase (NCBI ptt file))
to HMM TIGR01296 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01296.hmm # target sequence database: /tmp/gapView.23732.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01296 [M=339] Accession: TIGR01296 Description: asd_B: aspartate-semialdehyde dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-140 452.3 0.3 5.8e-140 452.1 0.3 1.0 1 lcl|FitnessBrowser__Btheta:353162 BT3636 aspartate-semialdehyde de Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Btheta:353162 BT3636 aspartate-semialdehyde dehydrogenase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 452.1 0.3 5.8e-140 5.8e-140 1 338 [. 2 331 .. 2 332 .. 0.98 Alignments for each domain: == domain 1 score: 452.1 bits; conditional E-value: 5.8e-140 TIGR01296 1 nvaivGatGavGqellkvLeernfpidklvllasersaGkkvkfkgkeleveeaeke.sfegidialfsaGgsvsk 75 +vaivG +GavGqe+l+vL+ernfp+d+lvl+ s+rsaG+ +f+gk++ev+ ++++ +f+g+dia+ saG+ +sk lcl|FitnessBrowser__Btheta:353162 2 KVAIVGVSGAVGQEFLRVLDERNFPMDELVLFGSKRSAGTTYTFRGKQIEVKLLQHNdDFKGVDIAFTSAGAGTSK 77 69****************************************************99879***************** PP TIGR01296 76 efapkaakagviviDntsafrldedvPLvvpevnaeelkeakkkgiianPnCstiqlvvvLkplkdeaklkrvvvs 151 ef ++k g+++iDn+safr+d dvPLvvpevna++ e++ +g+ianPnC+tiq+vv+Lk++++ ++k v vs lcl|FitnessBrowser__Btheta:353162 78 EFEKTITKYGAVMIDNSSAFRMDADVPLVVPEVNAADALERP-RGVIANPNCTTIQMVVALKAIEQLSHIKTVHVS 152 ***************************************998.********************************* PP TIGR01296 152 tYqavsGaGkkgveeLknqtkavlegkekepeidalkakkfakqiafnaiplidklkedGytkeelkllfetrkil 227 tYqa sGaG+++++eL++q + vl + + +kfa+q+afn+ip+id ++e+Gytkee+k+ +etrki+ lcl|FitnessBrowser__Btheta:353162 153 TYQAASGAGAAAMDELYEQYRQVLANEPVT-------VEKFAYQLAFNLIPQIDVFTENGYTKEEMKMYNETRKIM 221 *********************999865555.......69************************************* PP TIGR01296 228 giedlkvsatcvrvPvftghsesvsiefekelsveevkelLkeapgvvviddpsenlyptPleavgkdevfvgrir 303 + +d+kvsatcvrvP +++hses+ +e+e+++svee++e + + +g+v++d+p e++yp+Pl +gkd v+vgrir lcl|FitnessBrowser__Btheta:353162 222 H-SDVKVSATCVRVPALRAHSESIWVETERPISVEEAREAFAKGEGLVLQDNPAEKEYPMPLFLAGKDPVYVGRIR 296 *.************************************************************************** PP TIGR01296 304 kDlskekglalfvvaDnlrkGaalnavqiaellik 338 kDl++e+gl+ ++v+D+++kGaalnavqiae lik lcl|FitnessBrowser__Btheta:353162 297 KDLTNENGLTFWIVGDQIKKGAALNAVQIAEYLIK 331 ********************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (339 nodes) Target sequences: 1 (335 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.80 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory