Align ATP phosphoribosyltransferase (EC 2.4.2.17) (characterized)
to candidate 349728 BT0200 ATP phosphoribosyltransferase (NCBI ptt file)
Query= BRENDA::Q5HSJ4 (299 letters) >FitnessBrowser__Btheta:349728 Length = 283 Score = 254 bits (648), Expect = 2e-72 Identities = 135/292 (46%), Positives = 202/292 (69%), Gaps = 11/292 (3%) Query: 7 LRIAIQKSGRLSKESIELLSECGVKMHIHEQSLIAFSTNLPIDILRVRDDDIPGLIFDGV 66 LRIA+Q GRL +E++ LL E +K+ +++L+ S+N PI++L +RDDDIP + GV Sbjct: 2 LRIAVQAKGRLFEETMALLGESDIKISTTKRTLLVQSSNFPIEVLFLRDDDIPQTVATGV 61 Query: 67 VDLGIIGENVLEENELERQSLGENPSYKLLKKLDFGYCRLSLALPQENKFQNLKDFEGLR 126 DLGI+GEN E E + + ++K+L F CRLSLA+P++ ++ L F G + Sbjct: 62 ADLGIVGENEFMEKEEDAE---------IIKRLGFSKCRLSLAMPKDIEYPGLSWFNGKK 112 Query: 127 IATSYPQLLKRFMKENGINYKNCTLTGSVEVAPRANLADAICDLVSSGATLQANNLKEVK 186 IATSYP +L+ F+K+NG+N + +TGSVEV+P LADAI D+VSSG+TL +N LKEV+ Sbjct: 113 IATSYPVILRNFLKKNGVNAEIHVITGSVEVSPGIGLADAIFDIVSSGSTLVSNRLKEVE 172 Query: 187 VIYESRACLIQKENALSKEKQALVDKIMLRVAGVMQARESKYIMLHAPKEKLDKIQALLP 246 V+ +S A LI +N +S EK+ ++++++ R+ V A + KY++++APK+KL++I A+LP Sbjct: 173 VVMKSEALLIGNKN-MSDEKKEVLEELLFRMNAVKTAEDKKYVLMNAPKDKLEEIIAVLP 231 Query: 247 GVERPTILPLAHDEKNVALHMVSKENLFWETMEALKEEGASSILVLPIEKML 298 G++ PTI+PLA E ++H V E FWE + LK GA ILVLPIEKM+ Sbjct: 232 GMKSPTIMPLA-QEGWCSVHTVLDEKRFWEIIGKLKGLGAEGILVLPIEKMI 282 Lambda K H 0.317 0.135 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 283 Length adjustment: 26 Effective length of query: 273 Effective length of database: 257 Effective search space: 70161 Effective search space used: 70161 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate 349728 BT0200 (ATP phosphoribosyltransferase (NCBI ptt file))
to HMM TIGR00070 (hisG: ATP phosphoribosyltransferase (EC 2.4.2.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00070.hmm # target sequence database: /tmp/gapView.12046.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00070 [M=183] Accession: TIGR00070 Description: hisG: ATP phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-64 201.6 0.0 6.6e-64 201.2 0.0 1.1 1 lcl|FitnessBrowser__Btheta:349728 BT0200 ATP phosphoribosyltransfe Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Btheta:349728 BT0200 ATP phosphoribosyltransferase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 201.2 0.0 6.6e-64 6.6e-64 1 182 [. 2 182 .. 2 183 .. 0.99 Alignments for each domain: == domain 1 score: 201.2 bits; conditional E-value: 6.6e-64 TIGR00070 1 lriAlp.KGrleeetlkllekaglklskkeerkliasaedeevevlllrakdiptyvekgaadlGitGkDlleEse 75 lriA++ KGrl+eet++ll ++++k+s+++ r+l++++++ ++evl+lr++dip++v++g+adlGi+G++ ++E+e lcl|FitnessBrowser__Btheta:349728 2 LRIAVQaKGRLFEETMALLGESDIKISTTK-RTLLVQSSNFPIEVLFLRDDDIPQTVATGVADLGIVGENEFMEKE 76 89****************************.********************************************* PP TIGR00070 76 advvelldlgfgkcklvlAvpeesdvesledlkegkriATkypnltreylekkgvkveivkleGavElapllglad 151 +d + +++lgf+kc+l+lA+p++ ++ l+ ++ gk+iAT+yp + r++l+k+gv++ei ++G+vE++p +glad lcl|FitnessBrowser__Btheta:349728 77 EDAEIIKRLGFSKCRLSLAMPKDIEYPGLSWFN-GKKIATSYPVILRNFLKKNGVNAEIHVITGSVEVSPGIGLAD 151 *********************************.9***************************************** PP TIGR00070 152 aIvDivetGttLrengLkiieeilessarli 182 aI+Div++G+tL +n+Lk++e++++s+a li lcl|FitnessBrowser__Btheta:349728 152 AIFDIVSSGSTLVSNRLKEVEVVMKSEALLI 182 *****************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (183 nodes) Target sequences: 1 (283 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 10.19 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory