Align 3-isopropylmalate dehydratase small subunit 1; Alpha-IPM isomerase 1; IPMI 1; Isopropylmalate isomerase 1; EC 4.2.1.33 (characterized)
to candidate 351387 BT1859 3-isopropylmalate dehydratase small subunit (NCBI ptt file)
Query= SwissProt::P04787 (201 letters) >FitnessBrowser__Btheta:351387 Length = 200 Score = 157 bits (397), Expect = 1e-43 Identities = 88/196 (44%), Positives = 123/196 (62%), Gaps = 7/196 (3%) Query: 4 KFTQHTGLVVPLDAANVDTDAIIPKQFLQKVTRTG--FGAHLFNDWRFLDEKGQQPNPEF 61 KF T VPL NVDTD IIP +FL+ TR FG +LF DWR+ + N +F Sbjct: 5 KFNIITSTCVPLPLENVDTDQIIPARFLKATTREEKFFGDNLFRDWRYNADGSL--NKDF 62 Query: 62 VLNFPEYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAPSFADIFYGNSFNNQLLP 121 VLN P Y G IL+A +NFG GSSREHA WA+ YGF+VV++ FADI N NN +LP Sbjct: 63 VLNDPTYSG-QILVAGKNFGSGSSREHAAWAIAGYGFRVVVSSFFADIHKNNELNNFVLP 121 Query: 122 VTLSDAQVDELFALVKANPGIKFEVDLEAQVV--KAGDKTYSFKIDDFRRHCMLNGLDSI 179 V +++ + ELF + A+P ++ EV+L Q + KA K+ F+I+ +++ C++NGLD I Sbjct: 122 VVVTEGFLQELFDSIFADPKMEVEVNLPEQTITNKATGKSEHFEINAYKKLCLMNGLDDI 181 Query: 180 GLTLQHEDAIAAYENK 195 L +++ I +ENK Sbjct: 182 DFLLSNKNKIEEWENK 197 Lambda K H 0.321 0.138 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 140 Number of extensions: 9 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 201 Length of database: 200 Length adjustment: 21 Effective length of query: 180 Effective length of database: 179 Effective search space: 32220 Effective search space used: 32220 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate 351387 BT1859 (3-isopropylmalate dehydratase small subunit (NCBI ptt file))
to HMM TIGR00171 (leuD: 3-isopropylmalate dehydratase, small subunit (EC 4.2.1.33))
../bin/blast/fastacmd -i /tmp/list.29984.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.29984.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.