Align aspartate kinase (EC 2.7.2.4) (characterized)
to candidate 350903 BT1375 aspartokinase (NCBI ptt file)
Query= BRENDA::Q9LYU8 (569 letters) >FitnessBrowser__Btheta:350903 Length = 439 Score = 238 bits (608), Expect = 3e-67 Identities = 165/462 (35%), Positives = 252/462 (54%), Gaps = 32/462 (6%) Query: 89 VMKFGGSSVASAERMKEVADLILTFPEESPVIVLSAMGKTTNNLLLAGEKAVSCGVSNAS 148 V+KFGG+SV SA+RMKEVA LI E ++VLSAM TTN L+ + A+ Sbjct: 3 VLKFGGTSVGSAQRMKEVAKLITD--GEQKIVVLSAMSGTTNTLVEISDYLYKKNPEGAN 60 Query: 149 EIEELSIIKELHIRTVKELNIDPSVILTYLEELEQLLKGI-AMMKEL-TLRTRDYLVSFG 206 EI ++ ++ + + V EL LE ++ I + K+L TL +++ G Sbjct: 61 EI--INKLESKYKQHVDELFATQEYKQKGLEVIKSHFDYIRSYTKDLFTLFEEKVVLAQG 118 Query: 207 ECLSTRIFAAYLNTIGVKARQYDAFEIGFITTDDFTNGDILEATYPAVAKRLYDDWMH-- 264 E +ST + YL GVK+ A E F+ TD D P K + Sbjct: 119 ELISTAMVNFYLQECGVKSVLLPALE--FMRTDKNAEPD------PVYIKEKLQTQLELY 170 Query: 265 -DPAVPIVTGFLGKGWKTGAVTTLGRGGSDLTATTIGKALGLKEIQVWKDVDGVLTCDPT 323 D + I GF+ + G + L RGGSD TA+ IG A+ EIQ+W D+DG+ DP Sbjct: 171 PDMEIYITQGFICRN-AYGEIDNLQRGGSDYTASLIGAAVKASEIQIWTDIDGMHNNDPR 229 Query: 324 IYKRATPVPYLTFDEAAELAYFGAQVLHPQSMRPAREGEIPVRVKNSYNPKAPGTIITKT 383 I + PV L F+EAAELAYFGA++LHP ++PA+ IPVR+ N+ +P APGT+I + Sbjct: 230 IVDKTAPVRQLHFEEAAELAYFGAKILHPTCIQPAKYANIPVRLLNTMDPDAPGTLI--S 287 Query: 384 RDMTKSILTSIVLKRNVTMLDIASTRMLGQVGFLAKVFSIFEELGISVDVVATSEVSISL 443 D K + ++ K N+T + I S+RML GFL KVF IFE S+D++ TSEV +S+ Sbjct: 288 NDTEKGKIKAVAAKNNITAIKIKSSRMLLAHGFLRKVFEIFESYQTSIDMICTSEVGVSV 347 Query: 444 TLDPSKLWSRELIQQELDHVVEELEKIAVVNLLKGRAIISLIGNVQHSSLILE-RAFHVL 502 T+D +K L+ ++++L+K V + K II ++G+++ ++ E +A + Sbjct: 348 TIDNTK---------HLNEILDDLKKYGTVTVDKDMCIICVVGDLEWENVGFEAKALDAM 398 Query: 503 YTKGVNVQMISQGASKVNISFIVNEAEAEGCVQALHKSFFES 544 + + V+MIS G S NISF++ + + + +Q+L F + Sbjct: 399 --RDIPVRMISFGGSNYNISFLIRDCDKKTALQSLSDMLFNN 438 Lambda K H 0.318 0.134 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 461 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 569 Length of database: 439 Length adjustment: 34 Effective length of query: 535 Effective length of database: 405 Effective search space: 216675 Effective search space used: 216675 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
Align candidate 350903 BT1375 (aspartokinase (NCBI ptt file))
to HMM TIGR00657 (aspartate kinase (EC 2.7.2.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00657.hmm # target sequence database: /tmp/gapView.10721.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00657 [M=442] Accession: TIGR00657 Description: asp_kinases: aspartate kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-96 310.0 0.1 1.8e-96 309.8 0.1 1.0 1 lcl|FitnessBrowser__Btheta:350903 BT1375 aspartokinase (NCBI ptt f Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Btheta:350903 BT1375 aspartokinase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 309.8 0.1 1.8e-96 1.8e-96 5 441 .. 3 436 .. 1 437 [. 0.90 Alignments for each domain: == domain 1 score: 309.8 bits; conditional E-value: 1.8e-96 TIGR00657 5 VqKFGGtSvgnverikkvakivkkekekgnqvvVVvSAmagvTdaLvelaekvsseee...keliekirekhleal 77 V+KFGGtSvg+++r+k+vak+++ + q +VV+SAm+g+T+ Lve+++ + +++ +e+i+k+++k + + lcl|FitnessBrowser__Btheta:350903 3 VLKFGGTSVGSAQRMKEVAKLITDGE----QKIVVLSAMSGTTNTLVEISDYLYKKNPegaNEIINKLESKYKQHV 74 89********************9877....889*****************99877776688889999999999999 PP TIGR00657 78 eela.sqalkeklkallekeleevkk.......ereldlilsvGEklSaallaaaleelgvkavsllgaeagiltd 145 +el q+ k+k ++++++++ +++ e+ ++l+ GE +S+a++ +l+e gvk+v ll a + ++td lcl|FitnessBrowser__Btheta:350903 75 DELFaTQEYKQKGLEVIKSHFDYIRSytkdlftLFEEKVVLAQGELISTAMVNFYLQECGVKSV-LLPALEFMRTD 149 998889999999999999999999889999998778889*********************8777.56667789999 PP TIGR00657 146 sefgrAk.vleeikterleklleegiivvvaGFiGatekgeittLGRGGSDltAallAaalkAdeveiytDVdGiy 220 ++ + +++e + +le + + i++++GFi + gei L RGGSD+tA+l++aa+kA+e++i+tD+dG + lcl|FitnessBrowser__Btheta:350903 150 KNAEPDPvYIKEKLQTQLELYPD-MEIYITQGFICRNAYGEIDNLQRGGSDYTASLIGAAVKASEIQIWTDIDGMH 224 88766553444444444444443.47************************************************** PP TIGR00657 221 taDPrivpeArrldeisyeEalELaslGakvLhprtlepamrakipivvkstfnpeaeGTlivakskseeepavka 296 DPriv ++ + ++ +eEa+ELa++Gak+Lhp +++pa+ a+ip++ +t++p+a+GTli ++++ + ++ka lcl|FitnessBrowser__Btheta:350903 225 NNDPRIVDKTAPVRQLHFEEAAELAYFGAKILHPTCIQPAKYANIPVRLLNTMDPDAPGTLISNDTE---KGKIKA 297 *****************************************************************55...578*** PP TIGR00657 297 lsldknqalvsvsgttmk..pgilaevfgalaeakvnvdlilqsssetsisfvvdkedadkakellkkkvkeekal 370 ++ ++n + ++++++ m g+l +vf++ ++ + ++d+i +se ++s ++d ++++ +e+l +++k+ lcl|FitnessBrowser__Btheta:350903 298 VAAKNNITAIKIKSSRMLlaHGFLRKVFEIFESYQTSIDMIC--TSEVGVSVTID--NTKHLNEIL----DDLKKY 365 *****************999**********************..77767666665..555666664....678999 PP TIGR00657 371 eevevekklalvslvGagmksapgvaakifeaLaeeniniemis..sseikisvvvdekdaekavealheklv 441 ++v+v+k+++++ +vG+ ++ g ak+++a+++ i+++mis s+++is+++++ d ++a++ l ++l+ lcl|FitnessBrowser__Btheta:350903 366 GTVTVDKDMCIICVVGDLEWENVGFEAKALDAMRD--IPVRMISfgGSNYNISFLIRDCDKKTALQSLSDMLF 436 *********************************99..********9***********************9998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (442 nodes) Target sequences: 1 (439 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 11.41 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory