Align Methionine synthase component, B12 binding and B12-binding cap domains (EC:2.1.1.13) (characterized)
to candidate 349708 BT0180 5-methyltetrahydrofolate-homocysteine methyltransferase (NCBI ptt file)
Query= reanno::Phaeo:GFF1319 (233 letters) >FitnessBrowser__Btheta:349708 Length = 915 Score = 100 bits (250), Expect = 7e-26 Identities = 58/183 (31%), Positives = 105/183 (57%), Gaps = 5/183 (2%) Query: 15 DEDLVQQMFDDLYDGLKEEIEESVNILLERGWAPYKVLTEALVGGMTIVGADFRDGILFV 74 +E + +++ L G+ + +E+ + L V+ L+ GM VG F G +F+ Sbjct: 655 EESVQERLKYALMKGIGDYLEQDLAEALPLYDKAVDVIEGPLMDGMNYVGELFGAGKMFL 714 Query: 75 PEVLLAANAMKGGMAILKPLLAET---GAPRMGSMVIGTVKGDIHDIGKNLVSMMMEGAG 131 P+V+ A MK +AIL+P++ G+ G +++ TVKGD+HDIGKN+V+++M G Sbjct: 715 PQVVKTARTMKKAVAILQPIIESEKVEGSSSAGKVLLATVKGDVHDIGKNIVAVVMACNG 774 Query: 132 FEVVDIGINNPVENYLEALEEHQPDILGMSALLTTTMPYMKVVIDTMIEQGKRDDYIVLV 191 +++VD+G+ P E ++ E + D++G+S L+T ++ M V + + G D +L+ Sbjct: 775 YDIVDLGVMVPAETIVQRAIEEKVDMIGLSGLITPSLEEMTHVAAELEKAGL--DIPLLI 832 Query: 192 GGA 194 GGA Sbjct: 833 GGA 835 Lambda K H 0.318 0.138 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 496 Number of extensions: 25 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 915 Length adjustment: 33 Effective length of query: 200 Effective length of database: 882 Effective search space: 176400 Effective search space used: 176400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory