Align aspartate transaminase (EC 2.6.1.1); aspartate-prephenate aminotransferase (EC 2.6.1.78); glutamate-prephenate aminotransferase (EC 2.6.1.79) (characterized)
to candidate 353246 BT3720 putative aspartate aminotransferase (NCBI ptt file)
Query= BRENDA::Q9SIE1 (475 letters) >FitnessBrowser__Btheta:353246 Length = 383 Score = 209 bits (531), Expect = 2e-58 Identities = 136/397 (34%), Positives = 206/397 (51%), Gaps = 26/397 (6%) Query: 73 SPRVQSLKPSKTMVITDLAATLVQSGVPVIRLAAGEPDFDTPKVVAEAGINAIREGFTRY 132 +P+V+ + M + + A L + GV VI L GEPDFD P VAEA A T Y Sbjct: 5 NPQVEQMTSFIVMDVLERANELQKQGVDVIHLEVGEPDFDVPACVAEAAKAAYDRHLTHY 64 Query: 133 TLNAGITELREAICRKLKEENGLSYAPDQILVSNGAKQSLLQAVLAVCSPGDEVIIPAPY 192 T + G ELR I + E G++ PD I+V++G+ S+L ++ +C+ EVI+ P Sbjct: 65 THSLGDPELRREIAAFYQREYGVTVDPDCIVVTSGSSPSILLVLMLLCNSDSEVILSNPG 124 Query: 193 WVSYTEQARLADATPVVIPTKISNNFLLDPKDLESKLTEKSRLLILCSPSNPTGSVYPKS 252 + Y A A PV++P N D + + +T + + + SP NPTG + +S Sbjct: 125 YACYRNFVLAAQAKPVLVPLSEENGLQYDIEAIRKCVTPHTAGIFINSPMNPTGMLLDES 184 Query: 253 LLEEIARIIAKHPRLLVLSDEIYEHIIYAPATHTSFASLPDMYERTLTVNGFSKAFAMTG 312 L +A + + ++SDEIY ++Y H S+ + ++ +NGFSK FAMTG Sbjct: 185 FLRSVASL-----GVPIISDEIYHGLVYEGRAH----SILEYTDKAFVLNGFSKRFAMTG 235 Query: 313 WRLGYLAGPKHIVAACSKLQGQVSSGASSIAQKAGVAALGLGKAGGETVAEMVKAYRERR 372 RLGYL PK + + KLQ + ASSIAQ+AG+AAL + V M + Y ERR Sbjct: 236 LRLGYLIAPKSCMRSLQKLQQNLFICASSIAQQAGIAAL---RQADSDVERMKQIYDERR 292 Query: 373 DFLVKSLGDIKGVKIS-EPQGAFYLFIDFSAYYGSEAEGFGLINDSSSLALYFLDKFQVA 431 +++ L ++ G +I EPQGAFY+F D + DS A L+ V Sbjct: 293 RYMISRLREM-GFEIKVEPQGAFYIFADARKF----------TTDSYRFAFDVLENAHVG 341 Query: 432 MVPGDAF--GDDSCIRISYATSLDVLQAAVEKIRKAL 466 + PG F G + +R SYA SL+ ++ +++I + L Sbjct: 342 ITPGIDFGTGGEGYVRFSYANSLESIREGLDRISQYL 378 Lambda K H 0.317 0.132 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 366 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 475 Length of database: 383 Length adjustment: 32 Effective length of query: 443 Effective length of database: 351 Effective search space: 155493 Effective search space used: 155493 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory