Align Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 (uncharacterized)
to candidate 350295 BT0767 putative para-aminobenzoate synthase component I (NCBI ptt file)
Query= curated2:P14953 (494 letters) >FitnessBrowser__Btheta:350295 Length = 330 Score = 102 bits (255), Expect = 2e-26 Identities = 64/194 (32%), Positives = 104/194 (53%), Gaps = 14/194 (7%) Query: 292 SPEMLVRVENGIVETCPIAGTRKRGRTKEEDEALEKELLSDEKEIAEHVMLVDLGRNDIG 351 SPE+ VR++ G + + P+ GT + ++L+ D KE AEH +VDL RND+ Sbjct: 139 SPEIFVRIQQGKISSYPMKGTLDASLP-----SAVRQLMDDPKEAAEHATIVDLIRNDLS 193 Query: 352 RVSKFGTVAVKNLMHIERYSH----VMHVVTNVQGEIRED--KTPFDALMSILPAGTLSG 405 V+ V+V +I++ ++ + +QG + ++ + L +LPAG+++G Sbjct: 194 IVAD--RVSVSRYRYIDKLQTNRGTILQTSSEIQGTLPDNYRENLGHILFKLLPAGSITG 251 Query: 406 APKVRAMEIIDELETVKRGPYGGAIGYLSFNGNLDSCITIRTIILKDGKAYVQAGAGIVA 465 APK + M+II E ET +RG Y G +GY +LDS + IR + + + Y ++G GI Sbjct: 252 APKKKTMQIISEAETYERGFYTGVMGYFD-GSSLDSAVMIRFVEQEGDRMYFKSGGGITC 310 Query: 466 DSVPEREYEECYNK 479 S E EY E K Sbjct: 311 RSEVESEYHEMKQK 324 Lambda K H 0.319 0.138 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 371 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 494 Length of database: 330 Length adjustment: 31 Effective length of query: 463 Effective length of database: 299 Effective search space: 138437 Effective search space used: 138437 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory