Align aspartate-prephenate aminotransferase (EC 2.6.1.78) (characterized)
to candidate 353246 BT3720 putative aspartate aminotransferase (NCBI ptt file)
Query= BRENDA::Q56232 (385 letters) >FitnessBrowser__Btheta:353246 Length = 383 Score = 214 bits (545), Expect = 3e-60 Identities = 135/388 (34%), Positives = 203/388 (52%), Gaps = 12/388 (3%) Query: 1 MRGLSRRVQAMKPSATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQG 60 M+ + +V+ M + V +A EL++QGVD++ L GEPDFD P V EAA+ A + Sbjct: 1 MKHTNPQVEQMTSFIVMDVLERANELQKQGVDVIHLEVGEPDFDVPACVAEAAKAAYDRH 60 Query: 61 KTKYAPPAGIPELREALAEKFRRENGLSVTPEETIVTVGGKQALFNLFQAILDPGDEVIV 120 T Y G PELR +A ++RE G++V P+ +VT G ++ + + + EVI+ Sbjct: 61 LTHYTHSLGDPELRREIAAFYQREYGVTVDPDCIVVTSGSSPSILLVLMLLCNSDSEVIL 120 Query: 121 LSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDPERVRRAITPRTKALVVNSPNNPTGAV 180 +P + Y V A V V E G D E +R+ +TP T + +NSP NPTG + Sbjct: 121 SNPGYACYRNFVLAAQAKPVLVPLSEENGLQYDIEAIRKCVTPHTAGIFINSPMNPTGML 180 Query: 181 YPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHFSPGRVAPEHTLTVNGAAKAFAMTG 240 + L ++A L V ++SDEIY L+YEG S + +NG +K FAMTG Sbjct: 181 LDESFLRSVASLGVP----IISDEIYHGLVYEGRAHSILEYT-DKAFVLNGFSKRFAMTG 235 Query: 241 WRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRRR 300 R+GY PK ++++ + +IAQ A + AL ++ VE ++ Y RR Sbjct: 236 LRLGYLIAPKSCMRSLQKLQQNLFICASSIAQQAGIAALRQADSD---VERMKQIYDERR 292 Query: 301 DLLLEGLTALGLK-AVRPSGAFYVLMDTSPIAPDEVRAAERLLE-AGVAVVPGTDF--AA 356 ++ L +G + V P GAFY+ D D R A +LE A V + PG DF Sbjct: 293 RYMISRLREMGFEIKVEPQGAFYIFADARKFTTDSYRFAFDVLENAHVGITPGIDFGTGG 352 Query: 357 FGHVRLSYATSEENLRKALERFARVLGR 384 G+VR SYA S E++R+ L+R ++ L R Sbjct: 353 EGYVRFSYANSLESIREGLDRISQYLSR 380 Lambda K H 0.317 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 314 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 383 Length adjustment: 30 Effective length of query: 355 Effective length of database: 353 Effective search space: 125315 Effective search space used: 125315 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory