GapMind for Amino acid biosynthesis

 

Aligments for a candidate for tyrB in Bacteroides thetaiotaomicron VPI-5482

Align Aromatic-amino-acid transaminase (EC 2.6.1.57) (characterized)
to candidate 349730 BT0202 histidinol-phosphate aminotransferase (NCBI ptt file)

Query= reanno::BFirm:BPHYT_RS14905
         (370 letters)



>lcl|FitnessBrowser__Btheta:349730 BT0202 histidinol-phosphate
           aminotransferase (NCBI ptt file)
          Length = 346

 Score =  147 bits (370), Expect = 6e-40
 Identities = 110/352 (31%), Positives = 182/352 (51%), Gaps = 30/352 (8%)

Query: 20  KPISEVAREFGLDEATIVKLASNENPLGMPESAQRAMAQAASELGRYPDANAFELKAALS 79
           KP S    E+    A++  L +NENP  +P +             RYPD   +ELK  LS
Sbjct: 16  KPYSSARDEYKGAVASVF-LDANENPYNLPHN-------------RYPDPMQWELKTLLS 61

Query: 80  ERYGVPADWVTLGNGSNDILEIAAHAFVE-KGQSIVYAQYSFAVYALATQ--GLGARAIV 136
           +   V    + LGNGS++ +++   AF E +  ++V    ++ +Y +      +  R ++
Sbjct: 62  KIKKVSPQHIFLGNGSDEAIDLVFRAFCEPEKDNVVAIDPTYGMYQVCADVNNVEYRKVL 121

Query: 137 VPAVKYGHDLDAMLAAVSDDTRLIFVANPNNPTGTFIEGPKLEAFLDKVPRHVVVVLDEA 196
           +    +    + +LAA  + T+LIF+ +PNNPTG  +   ++E  L +     +V+LDEA
Sbjct: 122 LDE-NFQFSAEKLLAATDERTKLIFLCSPNNPTGNDLLRSEIEKILREFEG--LVILDEA 178

Query: 197 YTEYLPQEKRYDSIAWVRRYPNLLVSRTFSKAFGLAGLRVGFAIAQPELTDLLNRVRQPF 256
           Y ++       + +    +YPNL+V +TFSKA+G A +R+G A A   +  +L++++ P+
Sbjct: 179 YNDFSEAPSFLEELD---KYPNLVVFQTFSKAWGCAAIRLGMAFASEAIIGILSKIKYPY 235

Query: 257 NVNTLAQAAAIAALNDKAFLEKSAALNAQGYRRLTEAFDKLG--LEYVPSDGNFVLVRVG 314
           NVN L Q  AIA L+    +E+      +    L E F KL   +   PSD NF L +V 
Sbjct: 236 NVNQLTQQQAIAMLHKYYEIERWIKTLKEERDYLEEEFAKLSCTVRMYPSDSNFFLAKV- 294

Query: 315 NDDAAGNRVNLELLKQGVIVRPVGNYGL-PQWLRITIGLPEENEAFIAALER 365
             DA   ++   L+ +G+IVR   +  L    LR+T+G   EN   +AAL++
Sbjct: 295 -TDAV--KIYNYLVGEGIIVRNRHSISLCCNCLRVTVGTRVENNTLLAALKK 343


Lambda     K      H
   0.318    0.135    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 304
Number of extensions: 22
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 370
Length of database: 346
Length adjustment: 29
Effective length of query: 341
Effective length of database: 317
Effective search space:   108097
Effective search space used:   108097
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory