Align succinylornithine transaminase; EC 2.6.1.81 (characterized)
to candidate H281DRAFT_04057 H281DRAFT_04057 acetylornithine aminotransferase apoenzyme
Query= CharProtDB::CH_002469 (406 letters) >FitnessBrowser__Burk376:H281DRAFT_04057 Length = 394 Score = 290 bits (741), Expect = 7e-83 Identities = 161/359 (44%), Positives = 218/359 (60%), Gaps = 3/359 (0%) Query: 28 GEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTNEPVLRLA 87 G+GS L+D GK Y+DF G AVN LGH + EALN+QA ++ + NEP+ +LA Sbjct: 25 GKGSWLYDNNGKRYLDFIQGWAVNCLGHCDEGMIEALNQQAKLLFNPSPAFYNEPMAKLA 84 Query: 88 KKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFHGRTLFTVS 147 L + D+VFF NSGAEANE A+KLARK+ ++ I+ F ++FHGRTL T+S Sbjct: 85 ALLTQHSCFDKVFFANSGAEANEGAIKLARKWGK-KFKDGAFEIITFDHSFHGRTLATMS 143 Query: 148 AGGQPAYSQDFAPLPADIRHAAYNDINSASALIDDSTCAVIVEPIQGEGGVVPASNAFLQ 207 A G+P + +AP A NDI S LI+ T AV++EPIQGEGGV+PA+ F+Q Sbjct: 144 ASGKPGWDTIYAPQVPGFPKADLNDIASVEKLINAKTVAVMLEPIQGEGGVIPATREFMQ 203 Query: 208 GLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTAKALGGGFPVGALLATE 267 LREL +HN LLI DEVQ+G GR G L+AY GV PD++T K +GGG P+ ALLA Sbjct: 204 QLRELTRKHNVLLIVDEVQSGCGRAGTLFAYELSGVEPDIMTLGKGIGGGVPLAALLAKA 263 Query: 268 ECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINHRYG 327 E A V G G TY GNPL +AV V+ + P L GV+ R ++ +L ++ G Sbjct: 264 EVA-VFEAGDQGGTYNGNPLMTAVGYSVISQLTAPGFLEGVRARGEYLRAKLLELSEERG 322 Query: 328 LFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEV 386 F RG GLL +L D Q + +++ G+++ A N++RF PALNV+ EE+ Sbjct: 323 -FKGERGEGLLRALLLGKDIGNQIVEKARDMQPDGLLLNAARPNLLRFMPALNVTNEEI 380 Lambda K H 0.319 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 434 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 394 Length adjustment: 31 Effective length of query: 375 Effective length of database: 363 Effective search space: 136125 Effective search space used: 136125 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory