Align cysteine synthase (EC 2.5.1.47) (characterized)
to candidate H281DRAFT_03911 H281DRAFT_03911 cysteine synthase
Query= BRENDA::P29848 (303 letters) >lcl|FitnessBrowser__Burk376:H281DRAFT_03911 H281DRAFT_03911 cysteine synthase Length = 300 Score = 362 bits (929), Expect = e-105 Identities = 189/294 (64%), Positives = 219/294 (74%), Gaps = 4/294 (1%) Query: 3 TLEQTIGNTPLVKLQRLGPDN----GSEIWVKLEGNNPAGSVKDRAALSMIVEAEKRGEI 58 T+E TIGNTPLV+L RL D + + KLEGNNPAGSVKDR ALSMI +AE RG I Sbjct: 5 TIEDTIGNTPLVQLVRLPDDEIRSRNNVVLAKLEGNNPAGSVKDRPALSMIKKAEARGRI 64 Query: 59 KPGDVLIEATSGNTGIALAMIAALKGYRMKLLMPDNMSQERRAAMRAYGAELILVTKEQG 118 KPGD LIE+TSGNTGIALAM AA++GY+M L+MP+++S ERR +M AYGA++IL G Sbjct: 65 KPGDTLIESTSGNTGIALAMAAAIRGYKMVLIMPEDLSVERRQSMAAYGAQIILTPVTGG 124 Query: 119 MEGARDLALAMSERGEGKLLDQFNNPDNPYAHYTTTGPEIWRQTSGRITHFVSSMGTTGT 178 ME ARDLA M G+G +LDQF NPDNP AH TGPEIWR T GRITHFVSSMGTTGT Sbjct: 125 MEYARDLAEQMQRDGKGIILDQFANPDNPAAHVEGTGPEIWRDTEGRITHFVSSMGTTGT 184 Query: 179 ITGVSRFLREQEKPVTIVGLQPEEGSSIPGIRRWPAEYMPGIFNASLVDEVLDIHQNDAE 238 I GVS +L++Q + + IVG QPEEGS IPGIR+WP YMP IF+ S VD V ++ Q AE Sbjct: 185 IMGVSSYLKQQNQAIEIVGAQPEEGSRIPGIRKWPEAYMPKIFDRSRVDRVENVSQAAAE 244 Query: 239 NTMRELAVREGIFCGVSSGGAVAGALRVARATPGAIVVAIICDRGDRYLSTGVF 292 R LA EGIF G+SSGGA ALRVAR A +V I+CDRGDRYLSTGVF Sbjct: 245 AMARRLASVEGIFAGISSGGACEVALRVARQVENATIVFIVCDRGDRYLSTGVF 298 Lambda K H 0.316 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 312 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 300 Length adjustment: 27 Effective length of query: 276 Effective length of database: 273 Effective search space: 75348 Effective search space used: 75348 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate H281DRAFT_03911 H281DRAFT_03911 (cysteine synthase)
to HMM TIGR01138 (cysM: cysteine synthase B (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01138.hmm # target sequence database: /tmp/gapView.10865.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01138 [M=290] Accession: TIGR01138 Description: cysM: cysteine synthase B Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-137 442.5 0.4 4.6e-137 442.3 0.4 1.0 1 lcl|FitnessBrowser__Burk376:H281DRAFT_03911 H281DRAFT_03911 cysteine synthas Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Burk376:H281DRAFT_03911 H281DRAFT_03911 cysteine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 442.3 0.4 4.6e-137 4.6e-137 1 290 [] 5 298 .. 5 298 .. 0.99 Alignments for each domain: == domain 1 score: 442.3 bits; conditional E-value: 4.6e-137 TIGR01138 1 tilklvGntplvrlkrllpe....edsevlvklegnnpaGsvkdrpalsmiveaekrGeikeGdvl 62 ti++++Gntplv+l rl+ + ++ vl+klegnnpaGsvkdrpalsmi +ae rG ik+Gd+l lcl|FitnessBrowser__Burk376:H281DRAFT_03911 5 TIEDTIGNTPLVQLVRLPDDeirsRNNVVLAKLEGNNPAGSVKDRPALSMIKKAEARGRIKPGDTL 70 89****************99888778899************************************* PP TIGR01138 63 ieatsGntGialamvaalkGykvkllmpdnvseerkaalkayGaelilvdkeeGmeGardlarelv 128 ie+tsGntGialam+aa++Gyk+ l+mp++ s er++ + ayGa++il+ Gme ardla++++ lcl|FitnessBrowser__Burk376:H281DRAFT_03911 71 IESTSGNTGIALAMAAAIRGYKMVLIMPEDLSVERRQSMAAYGAQIILTPVTGGMEYARDLAEQMQ 136 ****************************************************************** PP TIGR01138 129 rkgeeklldqfnnpdnpkahytstGieiwqqtkGrithfvsslGttGtimGvsrflkeqnpavqiv 194 r g++ +ldqf+npdnp ah tG+eiw+ t+Grithfvss+GttGtimGvs +lk+qn+a++iv lcl|FitnessBrowser__Burk376:H281DRAFT_03911 137 RDGKGIILDQFANPDNPAAHVEGTGPEIWRDTEGRITHFVSSMGTTGTIMGVSSYLKQQNQAIEIV 202 ****************************************************************** PP TIGR01138 195 GlqpaegsaieGlrrieseylpgifdaslvdrvvdveqedaediarelakkegifvGvssGgavaa 260 G qp+egs i+G+r++++ y+p+ifd s+vdrv +v q ae +ar+la egif G+ssGga lcl|FitnessBrowser__Burk376:H281DRAFT_03911 203 GAQPEEGSRIPGIRKWPEAYMPKIFDRSRVDRVENVSQAAAEAMARRLASVEGIFAGISSGGACEV 268 ****************************************************************** PP TIGR01138 261 alrlarelekavvvaiicdrGdrylstgvf 290 alr+ar++e+a +v i+cdrGdrylstgvf lcl|FitnessBrowser__Burk376:H281DRAFT_03911 269 ALRVARQVENATIVFIVCDRGDRYLSTGVF 298 *****************************8 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (290 nodes) Target sequences: 1 (300 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.40 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory