GapMind for Amino acid biosynthesis

 

Aligments for a candidate for hisC in Paraburkholderia bryophila 376MFSha3.1

Align Histidinol-phosphate aminotransferase; EC 2.6.1.9; Imidazole acetol-phosphate transaminase (uncharacterized)
to candidate H281DRAFT_02293 H281DRAFT_02293 2-keto-4-methylthiobutyrate aminotransferase apoenzyme

Query= curated2:Q1GET3
         (362 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_02293 H281DRAFT_02293
           2-keto-4-methylthiobutyrate aminotransferase apoenzyme
          Length = 384

 Score = 85.9 bits (211), Expect = 2e-21
 Identities = 95/312 (30%), Positives = 142/312 (45%), Gaps = 40/312 (12%)

Query: 23  VDGVSNVTKLSSNEN-PLGPSPAAVEAMAEAAATMH--RYPSSDHATLRAAIAETHGLDA 79
           VDGV+   +   N+  P+    A  EA+A+   T++  RY  +   T+ A+ +E      
Sbjct: 48  VDGVAQAMRDGHNQYAPMAGIAALREALADKVQTLYGVRYDPTSEVTVIASASE------ 101

Query: 80  ERIICGAGSDEIIAFLCQCYAGPGDEVLYTEHGFAMYRISALAAGATPVEVKER--ERVT 137
                  G    I+ L      PGDEV+Y E  F  Y       GATPV +K    +   
Sbjct: 102 -------GLYSTISALVH----PGDEVIYFEPSFDSYGPIVRLQGATPVPIKLSLSDFRV 150

Query: 138 DVDALLAGCTAQTKLVFIANPNNPTGTMISEAEVARL-ADGIPEDAILVLDGAYAEYVEG 196
           + D + A  T +T+++ I  P+NPT T+ SEA+VARL A     D +++ D  Y   V  
Sbjct: 151 NWDEVAAAITPKTRMIIINTPHNPTATVFSEADVARLKAITRNTDIVILADEVYEHVV-- 208

Query: 197 FDAGAQLIAARHN-----VVMTRTFSKIYGLGGARVGWAYGPQEIIDVLNRVRG--PFNV 249
           FD       A H+      V+  +F K Y + G RVG+   P E+++ + +V     F+ 
Sbjct: 209 FDGAKHQSMACHSELAERSVIVSSFGKSYHVTGWRVGYCLAPAELMNEIRKVHQFMVFSA 268

Query: 250 ST-TALAGAEAAVRDTDYVQRCRLENAKWRGWLADQLAELG---VPSDTSCTNFILARFA 305
            T    A  +A      Y+        K R  LA  L+E     +PS+ S   F+LARF 
Sbjct: 269 DTPMQYAFVDALSNRESYLGLSAFYQQK-RDLLAHALSESRFELLPSEGSF--FMLARFR 325

Query: 306 SQSEAESCDDFL 317
             S+ ES  DF+
Sbjct: 326 GFSD-ESDSDFV 336


Lambda     K      H
   0.318    0.133    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 294
Number of extensions: 12
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 362
Length of database: 384
Length adjustment: 30
Effective length of query: 332
Effective length of database: 354
Effective search space:   117528
Effective search space used:   117528
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory