Align Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 (characterized)
to candidate H281DRAFT_00539 H281DRAFT_00539 myo-inositol-1(or 4)-monophosphatase
Query= SwissProt::P95189 (260 letters) >FitnessBrowser__Burk376:H281DRAFT_00539 Length = 267 Score = 94.7 bits (234), Expect = 2e-24 Identities = 81/262 (30%), Positives = 124/262 (47%), Gaps = 12/262 (4%) Query: 3 HDDLMLALALADRADELTRVRFGALDL-RIDTKPDLTPVTDADRAVESDVRQTLGRDRPG 61 H L +A+ A RA ++ LDL ++ K VT+ D+A E+ + TL P Sbjct: 2 HPMLNIAVKAARRAAQIINRASLDLDLIQVSKKQHNDFVTEIDKASEAAIIDTLKTAYPD 61 Query: 62 DGVLGEEFGGSTTFTGRQWIVDPIDGTKNFVRGVPVWASLIALLEDGVPSVGVVSAPALQ 121 +L EE G S + QWI+DP+DGT NF+ G P + IAL G+ + VV P Sbjct: 62 HAILAEESGKSDNESEYQWIIDPLDGTTNFIHGFPYYCVSIALAHKGIVTQAVVYDPTRN 121 Query: 122 RRWWAARGRGAFAS---VDGARPHRLSVSSVAELHSASLSFSSLSGWARPGLRERFIGLT 178 + A+RGRGAF + + A+ RL+ L F G G +F +T Sbjct: 122 DLFTASRGRGAFLNDRRIRVAKRDRLADG----LIGTGFPFRETDGLEAYG--RQFAEMT 175 Query: 179 DTVWRVRAYG-DFLSYCLVAEGAVDIAAEPQVSVWDLAALDIVVREAGGRLTSLDGVAG- 236 +R G L VA G +D E ++ WD+AA +++ EAGG + + G + Sbjct: 176 QACAGLRRPGAAALDLANVAAGRMDGFFEQGLNPWDVAAGSLLITEAGGLVGNYTGDSEF 235 Query: 237 PHGGSAVATNGLLHDEVLTRLN 258 H G VA N ++ +++ L+ Sbjct: 236 LHVGEIVAGNPKIYAQMVPILS 257 Lambda K H 0.319 0.136 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 160 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 267 Length adjustment: 25 Effective length of query: 235 Effective length of database: 242 Effective search space: 56870 Effective search space used: 56870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory