Align threonine ammonia-lyase (EC 4.3.1.19) (characterized)
to candidate H281DRAFT_01887 H281DRAFT_01887 threonine ammonia-lyase, biosynthetic, long form
Query= BRENDA::P04968 (514 letters) >FitnessBrowser__Burk376:H281DRAFT_01887 Length = 281 Score = 303 bits (775), Expect = 7e-87 Identities = 149/280 (53%), Positives = 203/280 (72%), Gaps = 2/280 (0%) Query: 235 VGLFAEGVAVKRIGDETFRLCQEYLDDIITVDSDAICAAMKDLFEDVRAVAEPSGALALA 294 VGLF++G AVK +G+ETFRLC EYLDD++ V++DA+CAA+KD+F+D R+V EP+G+LA+A Sbjct: 3 VGLFSDGTAVKLVGEETFRLCSEYLDDVLLVNTDALCAAIKDVFQDTRSVLEPAGSLAVA 62 Query: 295 GMKKYIALHNIRGERLAHILSGANVNFHGLRYVSERCELGEQREALLAVTIPEEKGSFLK 354 G K+Y I + L I SGAN+NF +R+V+ER E+GE REA+ AVTIPEE+GSF + Sbjct: 63 GAKQYAEREGIENQTLIAITSGANMNFDRMRFVAERAEVGEAREAVFAVTIPEERGSFRR 122 Query: 355 FCQLLGGRSVTEFNYRFADAKNACIFVGVRLSRGLEERKEILQMLNDGGYSVVDLSDDEM 414 FC+L+G RSVTEFNYR A A++A IFVGV++ R E +I ++ VDL+ DE+ Sbjct: 123 FCELVGTRSVTEFNYRIAQAESAHIFVGVQI-RNRSESAQIAGAFEAHNFATVDLTFDEL 181 Query: 415 AKLHVRYMVGGRPSHPLQERLYSFEFPESPGALLRFLNTLGTYWNISLFHYRSHGTDYGR 474 +K H+RYMVGGR ERL+ FEFPE PGAL++FL+++ WNISLFHYR+ G DY Sbjct: 182 SKQHIRYMVGGRSPLAHDERLFRFEFPERPGALMKFLSSMAPDWNISLFHYRNQGADYSS 241 Query: 475 VLAAFELGDHE-PDFETRLNELGYDCHDETNNPAFRFFLA 513 +L ++ + +FE L LGY +ET+NP +R FLA Sbjct: 242 ILVGIQVPQTDNAEFERFLATLGYPHWEETHNPVYRLFLA 281 Lambda K H 0.321 0.138 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 375 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 514 Length of database: 281 Length adjustment: 30 Effective length of query: 484 Effective length of database: 251 Effective search space: 121484 Effective search space used: 121484 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align threonine ammonia-lyase (EC 4.3.1.19) (characterized)
to candidate H281DRAFT_04606 H281DRAFT_04606 threonine ammonia-lyase, biosynthetic, long form
Query= BRENDA::P04968 (514 letters) >FitnessBrowser__Burk376:H281DRAFT_04606 Length = 260 Score = 271 bits (694), Expect = 2e-77 Identities = 138/256 (53%), Positives = 185/256 (72%), Gaps = 4/256 (1%) Query: 15 EYLRAVLRAPVYEAAQVTPLQKMEKLSSRLDNVILVKREDRQPVHSFKLRGAYAMMAGLT 74 +YL+ L A VY+ A+ T L++ +LS+RL N + +KRED QPV SFK+RGAY MA + Sbjct: 5 DYLKKTLTARVYDVARETELERAPQLSARLRNPVYLKREDNQPVFSFKVRGAYNKMAHIP 64 Query: 75 EEQKAHGVITASAGNHAQGVAFSSARLGVKALIVMPTATADIKVDAVRGFGG---EVLLH 131 E GVITASAGNHAQGVA S+AR+GVKA+IV+P T +KVDAVR GG EV+ Sbjct: 65 AEALTRGVITASAGNHAQGVALSAARMGVKAIIVVPVTTPQVKVDAVRAHGGPTVEVVQF 124 Query: 132 GANFDEAKAKAIELSQQQGFTWVPPFDHPMVIAGQGTLALELL-QQDAHLDRVFVPVGGG 190 G ++ +A A++L +++G T+V PFD P VIAGQGT+A+E+L Q + +FVP+GGG Sbjct: 125 GESYSDAYGHAVQLQEERGLTFVHPFDDPYVIAGQGTVAMEILSQHQGPIHAIFVPIGGG 184 Query: 191 GLAAGVAVLIKQLMPQIKVIAVEAEDSACLKAALDAGHPVDLPRVGLFAEGVAVKRIGDE 250 GLAAGVA +K + P+IKVI V+ +DS + A+L AG V L VGLF++G AVK +G+E Sbjct: 185 GLAAGVAAYVKSVRPEIKVIGVQTDDSCAMAASLKAGERVTLNEVGLFSDGTAVKLVGEE 244 Query: 251 TFRLCQEYLDDIITVD 266 TFRLC EYLDD++ V+ Sbjct: 245 TFRLCSEYLDDVLLVN 260 Lambda K H 0.321 0.138 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 330 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 514 Length of database: 260 Length adjustment: 29 Effective length of query: 485 Effective length of database: 231 Effective search space: 112035 Effective search space used: 112035 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate H281DRAFT_01887 H281DRAFT_01887 (threonine ammonia-lyase, biosynthetic, long form)
to HMM TIGR01124 (ilvA: threonine ammonia-lyase, biosynthetic (EC 4.3.1.19))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01124.hmm # target sequence database: /tmp/gapView.5996.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01124 [M=499] Accession: TIGR01124 Description: ilvA_2Cterm: threonine ammonia-lyase, biosynthetic Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-138 449.0 0.1 1.1e-138 448.8 0.1 1.0 1 lcl|FitnessBrowser__Burk376:H281DRAFT_01887 H281DRAFT_01887 threonine ammoni Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Burk376:H281DRAFT_01887 H281DRAFT_01887 threonine ammonia-lyase, biosynthetic, long form # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 448.8 0.1 1.1e-138 1.1e-138 220 499 .] 1 280 [. 1 280 [. 1.00 Alignments for each domain: == domain 1 score: 448.8 bits; conditional E-value: 1.1e-138 TIGR01124 220 dqvGlfadGvavkevGdetfrlckeylddivlvdtdevcaaikdvfedtravlepaGalalaGlkk 285 ++vGlf+dG+avk vG+etfrlc eyldd++lv+td++caaikdvf+dtr+vlepaG+la+aG k+ lcl|FitnessBrowser__Burk376:H281DRAFT_01887 1 NEVGLFSDGTAVKLVGEETFRLCSEYLDDVLLVNTDALCAAIKDVFQDTRSVLEPAGSLAVAGAKQ 66 58**************************************************************** PP TIGR01124 286 yvakkgiedktlvailsGanlnfdrlryvseraelGeqreallavtipeekGsllkfvevlGerai 351 y++++gie++tl+ai+sGan+nfdr+r+v+erae+Ge rea++avtipee+Gs+++f+e++G r++ lcl|FitnessBrowser__Burk376:H281DRAFT_01887 67 YAEREGIENQTLIAITSGANMNFDRMRFVAERAEVGEAREAVFAVTIPEERGSFRRFCELVGTRSV 132 ****************************************************************** PP TIGR01124 352 tefnyrladdekahifvGvqlaeeeerkellarleeagykvvdltddelaklhvrylvGGraakve 417 tefnyr+a++e+ahifvGvq+++++e ++++ +e +++++vdlt del+k h+ry+vGGr+ ++ lcl|FitnessBrowser__Burk376:H281DRAFT_01887 133 TEFNYRIAQAESAHIFVGVQIRNRSESAQIAGAFEAHNFATVDLTFDELSKQHIRYMVGGRSPLAH 198 ****************************************************************** PP TIGR01124 418 nerlysfefperpGallkfletlqaewnislfhyrnhGadyGrvlvglevpdeeaeefeqflaelg 483 +erl++fefperpGal+kfl+++ ++wnislfhyrn Gady +lvg++vp+++++efe fla+lg lcl|FitnessBrowser__Burk376:H281DRAFT_01887 199 DERLFRFEFPERPGALMKFLSSMAPDWNISLFHYRNQGADYSSILVGIQVPQTDNAEFERFLATLG 264 ****************************************************************** PP TIGR01124 484 yryedetenpayrlfl 499 y ++et+np+yrlfl lcl|FitnessBrowser__Burk376:H281DRAFT_01887 265 YPHWEETHNPVYRLFL 280 ***************8 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (499 nodes) Target sequences: 1 (281 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.42 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory