GapMind for Amino acid biosynthesis

 

Aligments for a candidate for leuD in Paraburkholderia bryophila 376MFSha3.1

Align 3-isopropylmalate dehydratase small subunit 1; Alpha-IPM isomerase 1; IPMI 1; Isopropylmalate isomerase 1; EC 4.2.1.33 (characterized)
to candidate H281DRAFT_02540 H281DRAFT_02540 3-isopropylmalate dehydratase, small subunit (EC 4.2.1.33)

Query= SwissProt::P04787
         (201 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_02540 H281DRAFT_02540
           3-isopropylmalate dehydratase, small subunit (EC
           4.2.1.33)
          Length = 200

 Score =  128 bits (322), Expect = 6e-35
 Identities = 77/192 (40%), Positives = 105/192 (54%), Gaps = 12/192 (6%)

Query: 3   EKFTQHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFNDWRFLDEKGQQPNPEFV 62
           E+F   +G   PL   +VDTD II  + L  + +   G + F  WR          P+FV
Sbjct: 2   ERFQTVSGPAAPLLRRDVDTDIIIRIERLTGLPKDQLGQYAFEVWR---------GPDFV 52

Query: 63  LNFPEYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAPSFADIFYGNSFNNQLLPV 122
           L+   + GA IL+A  NFGCGSSRE A WAL   G +VVIAPSF +IF  N F N +LPV
Sbjct: 53  LDREPFVGAPILIAGANFGCGSSREAAVWALQGLGLRVVIAPSFGEIFMSNCFQNGVLPV 112

Query: 123 TLSDAQVDELFALVKANPGIKFEVDLEAQVVKAGDKT-YSFKIDDFRRHCMLNGLDSIGL 181
            L + QV  L    +A  G     DL+  V+ A D T + F++D  RR  ++ G D + L
Sbjct: 113 VLPEQQVANL--AEQAQSGAAVTADLDTCVITAPDGTSFPFQVDPVRREMLIEGADEMSL 170

Query: 182 TLQHEDAIAAYE 193
           TL+ +D I  ++
Sbjct: 171 TLRRQDLIRQWQ 182


Lambda     K      H
   0.321    0.138    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 112
Number of extensions: 5
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 201
Length of database: 200
Length adjustment: 21
Effective length of query: 180
Effective length of database: 179
Effective search space:    32220
Effective search space used:    32220
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 45 (21.9 bits)

Align candidate H281DRAFT_02540 H281DRAFT_02540 (3-isopropylmalate dehydratase, small subunit (EC 4.2.1.33))
to HMM TIGR00171 (leuD: 3-isopropylmalate dehydratase, small subunit (EC 4.2.1.33))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00171.hmm
# target sequence database:        /tmp/gapView.8031.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00171  [M=188]
Accession:   TIGR00171
Description: leuD: 3-isopropylmalate dehydratase, small subunit
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                    -----------
    5.9e-51  159.0   0.0    7.3e-51  158.7   0.0    1.1  1  lcl|FitnessBrowser__Burk376:H281DRAFT_02540  H281DRAFT_02540 3-isopropylmalat


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Burk376:H281DRAFT_02540  H281DRAFT_02540 3-isopropylmalate dehydratase, small subunit (EC 4.2.1.3
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  158.7   0.0   7.3e-51   7.3e-51       1     188 []       1     178 [.       1     178 [. 0.97

  Alignments for each domain:
  == domain 1  score: 158.7 bits;  conditional E-value: 7.3e-51
                                    TIGR00171   1 mkefkkltGlvvpldkanvdtdaiipkqflkkikrtGfgkhlfyewryldekGkepnpefvlnvpq 66 
                                                  m+ f++ +G ++pl + +vdtd ii  + l  + +  +g+++f  wr          p+fvl+ ++
  lcl|FitnessBrowser__Burk376:H281DRAFT_02540   1 MERFQTVSGPAAPLLRRDVDTDIIIRIERLTGLPKDQLGQYAFEVWRG---------PDFVLDREP 57 
                                                  899*******************************************95.........9******** PP

                                    TIGR00171  67 yqgasillarenfGcGssrehapwalkdyGfkviiapsfadifynnsfkngllpirlseeeveell 132
                                                  + ga il+a+ nfGcGssre a wal+  G++v+iapsf++if +n+f+ng+lp+ l+e++v +l 
  lcl|FitnessBrowser__Burk376:H281DRAFT_02540  58 FVGAPILIAGANFGCGSSREAAVWALQGLGLRVVIAPSFGEIFMSNCFQNGVLPVVLPEQQVANLA 123
                                                  **************************************************************9987 PP

                                    TIGR00171 133 alvknkglkltvdleaqkvkdsegkvysfeidefrkhcllnGldeigltlqkedei 188
                                                  ++ + +g  +t dl++  +++ +g    f++d+ r+++l++G de++ltl+++d i
  lcl|FitnessBrowser__Burk376:H281DRAFT_02540 124 EQ-AQSGAAVTADLDTCVITAPDGTSFPFQVDPVRREMLIEGADEMSLTLRRQDLI 178
                                                  66.568999******************************************99976 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (188 nodes)
Target sequences:                          1  (200 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 8.57
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory