Align 3-isopropylmalate dehydratase small subunit 1; EC 4.2.1.33; Alpha-IPM isomerase 1; IPMI 1; Isopropylmalate isomerase 1 (uncharacterized)
to candidate H281DRAFT_05063 H281DRAFT_05063 3-isopropylmalate/(R)-2-methylmalate dehydratase large subunit
Query= curated2:Q8TX94 (170 letters) >FitnessBrowser__Burk376:H281DRAFT_05063 Length = 652 Score = 70.9 bits (172), Expect = 4e-17 Identities = 50/128 (39%), Positives = 68/128 (53%), Gaps = 8/128 (6%) Query: 3 DVIRGRAWVFGDDIDTDQIIPGRYLTTQDPEELAKHVMEG-----ADPEFPEKVREGD-- 55 D+ A DD+ TD+I P LT D E LA+ G P + VR G Sbjct: 28 DLTETTAGTLRDDVSTDEITPMSVLTRFD-ERLARVPYVGFRAGERTPIGLDAVRAGGFC 86 Query: 56 VIVAGKNFGCGSSREHAPIALKAAGIACVVTRSFARIFYRNAINLGLPLVVCPGVDDAFE 115 V VAG +G GSSREH+P+A AGI V+ RSF RI+ +NA N+GL G+ + E Sbjct: 87 VTVAGNRYGKGSSREHSPVAEYRAGIRLVIARSFERIYRQNADNVGLFTSTDFGLLERME 146 Query: 116 DGQGIEVN 123 G+ I+++ Sbjct: 147 RGEAIDID 154 Lambda K H 0.321 0.143 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 316 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 170 Length of database: 652 Length adjustment: 28 Effective length of query: 142 Effective length of database: 624 Effective search space: 88608 Effective search space used: 88608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory