GapMind for Amino acid biosynthesis

 

Aligments for a candidate for ilvD in Paraburkholderia bryophila 376MFSha3.1

Align dihydroxyacid dehydratase (EC 4.2.1.9) (characterized)
to candidate H281DRAFT_00127 H281DRAFT_00127 dihydroxyacid dehydratase

Query= metacyc::MONOMER-18815
         (557 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_00127 H281DRAFT_00127
           dihydroxyacid dehydratase
          Length = 557

 Score = 1005 bits (2598), Expect = 0.0
 Identities = 493/556 (88%), Positives = 531/556 (95%)

Query: 1   MAFNKRSQNITQGVARSPNRSMYYALGYKKEDFDKPMVGIANGHSTITPCNAGLQRLADA 60
           M +N+RS+NITQGVARSPNRSMYYALGY+KEDFDKPM+GIANGHSTITPCNAGLQRLADA
Sbjct: 1   MPYNRRSKNITQGVARSPNRSMYYALGYQKEDFDKPMIGIANGHSTITPCNAGLQRLADA 60

Query: 61  AIDAIKASDANPQVFGTPTISDGMSMGTEGMKYSLISREVIADCIETAAQGQWMDGVVVI 120
           A+ A+K +DANPQ+FGTPTISDGMSMGTEGMKYSL+SREVIADCIET  QGQWMDGVVVI
Sbjct: 61  AVAAVKGADANPQIFGTPTISDGMSMGTEGMKYSLVSREVIADCIETCVQGQWMDGVVVI 120

Query: 121 GGCDKNMPGGMIALARTNVPGIYVYGGTIKPGNWKGKDLTIVSSFEAVGEFTAGRMSQED 180
           GGCDKNMPGGMI LAR NVPGIYVYGGTI+PGNWKG DLTIVSSFEAVGEFTAGRMSQED
Sbjct: 121 GGCDKNMPGGMIGLARMNVPGIYVYGGTIRPGNWKGTDLTIVSSFEAVGEFTAGRMSQED 180

Query: 181 FEGVEKNACPSTGSCGGMYTANTMSSSFEALGMSLLYSSTMANPDQEKVDSAAESARVLV 240
           FEGVE+NACPSTGSCGGMYTANTMSSSFEALGMSLLYSSTMANPDQEKVDSAAESARVLV
Sbjct: 181 FEGVERNACPSTGSCGGMYTANTMSSSFEALGMSLLYSSTMANPDQEKVDSAAESARVLV 240

Query: 241 EAIKQDIKPRDIITRKSIENAVALIMATGGSTNAVLHYLAIAHAAEVEWTIDDFERIRRK 300
           EA+K+D+KPRDIIT+KSIENAVA+IMATGGSTNAVLH+LAIAHAAEVEWTI+DFER+R+K
Sbjct: 241 EAVKKDLKPRDIITKKSIENAVAVIMATGGSTNAVLHFLAIAHAAEVEWTIEDFERMRKK 300

Query: 301 VPVICNLKPSGQYVATDLHKAGGIPQVMKILLKAGMLHGDCLTITGRTLAEELENVPDTP 360
           VPVICNLKPSGQYVATDLHKAGGIPQVMKILL AG+LHGDC+TITG+TLAEEL++VP  P
Sbjct: 301 VPVICNLKPSGQYVATDLHKAGGIPQVMKILLDAGLLHGDCITITGKTLAEELKDVPSRP 360

Query: 361 RADQDVILPIEKALYAEGHLAILKGNLAEEGAVAKITGLKNPVITGPARVFEDEQSAMEA 420
           RADQ VI PI++ALY EGHLAILKGNLAE+GAVAKITGLKNPVITGPARVF+DEQSA+EA
Sbjct: 361 RADQKVIFPIDQALYKEGHLAILKGNLAEDGAVAKITGLKNPVITGPARVFDDEQSALEA 420

Query: 421 ILADKINAGDILVLRYLGPKGGPGMPEMLAPTSAIIGKGLGESVGFITDGRFSGGTWGMV 480
           ILADKI AGD++VLRYLGPKGGPGMPEMLAPTSAIIGKGLGESVG ITDGRFSGGTWGMV
Sbjct: 421 ILADKIVAGDVVVLRYLGPKGGPGMPEMLAPTSAIIGKGLGESVGLITDGRFSGGTWGMV 480

Query: 481 VGHVAPEAYVGGTIALVQEGDSITIDAHKLLLQLNVADEELARRRANWKQPAPRYTRGVL 540
           VGHVAPEA+VGGTI LVQEGDSITIDAHKLLLQLNV D EL RRRA W+QP PRYTRGVL
Sbjct: 481 VGHVAPEAFVGGTIGLVQEGDSITIDAHKLLLQLNVDDAELQRRRAAWQQPQPRYTRGVL 540

Query: 541 AKFSKLASTASKGAVT 556
           AK+S LA  A+KGA+T
Sbjct: 541 AKYSALALPANKGAIT 556


Lambda     K      H
   0.316    0.133    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1176
Number of extensions: 39
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 557
Length of database: 557
Length adjustment: 36
Effective length of query: 521
Effective length of database: 521
Effective search space:   271441
Effective search space used:   271441
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (25.0 bits)

Align candidate H281DRAFT_00127 H281DRAFT_00127 (dihydroxyacid dehydratase)
to HMM TIGR00110 (ilvD: dihydroxy-acid dehydratase (EC 4.2.1.9))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00110.hmm
# target sequence database:        /tmp/gapView.15408.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00110  [M=543]
Accession:   TIGR00110
Description: ilvD: dihydroxy-acid dehydratase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                    -----------
   3.7e-227  741.1   3.3   4.2e-227  740.9   3.3    1.0  1  lcl|FitnessBrowser__Burk376:H281DRAFT_00127  H281DRAFT_00127 dihydroxyacid de


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Burk376:H281DRAFT_00127  H281DRAFT_00127 dihydroxyacid dehydratase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  740.9   3.3  4.2e-227  4.2e-227       1     541 [.      18     556 ..      18     557 .] 0.99

  Alignments for each domain:
  == domain 1  score: 740.9 bits;  conditional E-value: 4.2e-227
                                    TIGR00110   1 aarallkatGlkdedlekPiiavvnsyteivPghvhlkdlaklvkeeieaaGgvakefntiavsDG 66 
                                                  ++r++++a+G+++ed++kP+i+++n++++i+P++  l+ la+++ ++++ a + ++ f+t ++sDG
  lcl|FitnessBrowser__Burk376:H281DRAFT_00127  18 PNRSMYYALGYQKEDFDKPMIGIANGHSTITPCNAGLQRLADAAVAAVKGADANPQIFGTPTISDG 83 
                                                  68**************************************************************** PP

                                    TIGR00110  67 iamgheGmkysLpsreiiaDsvetvvkahalDalvvissCDkivPGmlmaalrlniPaivvsGGpm 132
                                                  ++mg+eGmkysL+sre+iaD +et v+++++D++vvi+ CDk++PG +++ +r+n+P i v+GG++
  lcl|FitnessBrowser__Burk376:H281DRAFT_00127  84 MSMGTEGMKYSLVSREVIADCIETCVQGQWMDGVVVIGGCDKNMPGGMIGLARMNVPGIYVYGGTI 149
                                                  ****************************************************************** PP

                                    TIGR00110 133 eagktklsekidlvdvfeavgeyaagklseeeleeiersacPtagsCsGlftansmacltealGls 198
                                                   +g+ k + ++++v+ feavge +ag++s+e+ e +er+acP++gsC+G++tan+m++ +ealG+s
  lcl|FitnessBrowser__Burk376:H281DRAFT_00127 150 RPGNWK-GTDLTIVSSFEAVGEFTAGRMSQEDFEGVERNACPSTGSCGGMYTANTMSSSFEALGMS 214
                                                  ******.9********************************************************** PP

                                    TIGR00110 199 lPgsstllatsaekkelakksgkrivelvkknikPrdiltkeafenaitldlalGGstntvLhlla 264
                                                  l +sst++  ++ek ++a +s++ +ve+vkk++kPrdi+tk+++ena+++++a+GGstn+vLh la
  lcl|FitnessBrowser__Burk376:H281DRAFT_00127 215 LLYSSTMANPDQEKVDSAAESARVLVEAVKKDLKPRDIITKKSIENAVAVIMATGGSTNAVLHFLA 280
                                                  ****************************************************************** PP

                                    TIGR00110 265 iakeagvklslddfdrlsrkvPllaklkPsgkkviedlhraGGvsavlkeldkegllhkdaltvtG 330
                                                  ia+ a+v+ +++df+r+++kvP++++lkPsg++v +dlh+aGG+++v+k l  +gllh d++t+tG
  lcl|FitnessBrowser__Burk376:H281DRAFT_00127 281 IAHAAEVEWTIEDFERMRKKVPVICNLKPSGQYVATDLHKAGGIPQVMKILLDAGLLHGDCITITG 346
                                                  ****************************************************************** PP

                                    TIGR00110 331 ktlaetlekvkvlr.vdqdvirsldnpvkkegglavLkGnlaeeGavvkiagveedilkfeGpakv 395
                                                  ktlae+l++v++++ +dq+vi ++d++++keg+la+LkGnlae+Gav+ki+g ++   +++Gpa+v
  lcl|FitnessBrowser__Burk376:H281DRAFT_00127 347 KTLAEELKDVPSRPrADQKVIFPIDQALYKEGHLAILKGNLAEDGAVAKITGLKN--PVITGPARV 410
                                                  **********998647999************************************..999****** PP

                                    TIGR00110 396 feseeealeailggkvkeGdvvviryeGPkGgPGmremLaPtsalvglGLgkkvaLitDGrfsGgt 461
                                                  f++e+ aleail+ k+ +Gdvvv+ry GPkGgPGm+emLaPtsa++g GLg++v+LitDGrfsGgt
  lcl|FitnessBrowser__Burk376:H281DRAFT_00127 411 FDDEQSALEAILADKIVAGDVVVLRYLGPKGGPGMPEMLAPTSAIIGKGLGESVGLITDGRFSGGT 476
                                                  ****************************************************************** PP

                                    TIGR00110 462 rGlsiGhvsPeaaegGaialvedGDkikiDienrkldlevseeelaerrakakkkearevkgaLak 527
                                                   G+++Ghv+Pea +gG+i+lv++GD i+iD+++  l+l+v+++el++rra+++++++r+++g+Lak
  lcl|FitnessBrowser__Burk376:H281DRAFT_00127 477 WGMVVGHVAPEAFVGGTIGLVQEGDSITIDAHKLLLQLNVDDAELQRRRAAWQQPQPRYTRGVLAK 542
                                                  ****************************************************************** PP

                                    TIGR00110 528 yaklvssadkGavl 541
                                                  y+ l+  a+kGa++
  lcl|FitnessBrowser__Burk376:H281DRAFT_00127 543 YSALALPANKGAIT 556
                                                  ************96 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (543 nodes)
Target sequences:                          1  (557 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.03u 0.01s 00:00:00.04 Elapsed: 00:00:00.04
# Mc/sec: 7.50
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory